KEGG   Desulfobacterium autotrophicum: HRM2_38620Help
Entry
HRM2_38620        CDS       T00861                                 

Gene name
aor7
Definition
hypothetical protein (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HRM2_38620 (aor7)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HRM2_38620 (aor7)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HRM2_38620 (aor7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4337739..4339568
Genome map
AA seq 609 aa AA seqDB search
MNGWIGKILRVNLTTGKISDETLDPKVAKDYIGGRGIGIYYLNKEVDPKCDPLGPENLMI
MMTGPLTGTAAPTGARYMVMTKSPLTGAVTCSNSGGMMPREMKRAGYDGIIFKGQSVKPV
YLWINNGKAELKDADHIWGKNVPDTTDLLLAETDPKARVACIGPAGENKVLFAGIMNERH
RAAGRSGVGAVMGSKNLKGVVVKGQNKINLADPDGFKTFNKKILDQYTSEAKVTPVGLTI
NGTSGVVAVTQAKGILPTKNWQQGTFEGWEDIQGTTLTEKYLVKNQGCFGCPIKCGRLTK
VTEPGFEGEGEGPEYETVYAMGSNCMINNLAAITKANYLCNELGLDTITMGATIACAMEL
VELGYISETEVGRSLKWGDGEALVELTRQTAYREGFGEKLAQGSYRLANGFGHPELAMVS
KKQEFPGYEPRGAKAMGLAYATSPIGGSHMRGDPAYFEIFGTTFSMDPLATKGKAGPTKR
IQDLSAIVDAAGLCIFFGARMLAEKNDTMSPTGMLTYLNTATGADYTIEELVMAAERITN
AERMFLVNEGFDRKDDSLPRRITDEPLPAGPAKGQTCDLQTMLDDYYKVQGWDNNGIPTK
ATLEKLGLT
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatggatcggcaaaattctccgtgttaatttaacaacaggaaaaataagcgat
gaaactctggaccccaaggttgccaaagactatatcggtggcaggggtatcggtatttac
tacctgaacaaggaagtagatcccaaatgtgatcccctgggacctgaaaacctcatgatc
atgatgacaggccccctcaccggcaccgctgcccccaccggcgcacggtatatggtcatg
accaaatcgccgttgaccggagctgtgacctgctccaactccggcggtatgatgccccgg
gagatgaaacgggccggttatgacggcatcatatttaaagggcaatccgtcaaaccggtt
tatctctggatcaacaacggcaaggcagaactgaaggatgccgaccatatctggggaaaa
aacgtcccggacacaacggacctgctccttgcagaaacagaccccaaggcccgtgtggcc
tgcattggtcctgccggggaaaacaaggtcttgtttgccggtatcatgaacgaacgtcac
cgtgccgcaggcagatccggtgtgggtgctgtcatgggttccaaaaacctcaagggcgtt
gtggtcaaaggccagaataaaattaacctggctgaccccgacggattcaagaccttcaac
aaaaaaatcctggatcagtacaccagcgaagccaaggtaacaccggtgggactcaccatc
aatggcacatccggcgtggtggccgtgacccaggcaaaggggattctccccaccaaaaac
tggcagcagggcacctttgaaggctgggaagatatccagggcaccaccctcaccgaaaaa
tatctggtgaaaaaccaaggctgctttggctgtcccatcaaatgcggcagactcaccaag
gtgacggaacccggctttgagggggaaggcgaaggtcctgaatatgagaccgtctacgcc
atgggctccaactgcatgatcaataatctggccgccattaccaaggccaattatctgtgc
aacgaactgggccttgacaccatcaccatgggcgccaccatagcctgtgccatggagctt
gtggaacttggctatatatcagaaaccgaagtgggccgttccctgaaatggggagacggc
gaagcattggtggaactaacccgccagaccgcctatcgtgaaggctttggcgaaaaactg
gcccagggcagttatcgcctggctaatgggtttggccacccggagcttgccatggtctcc
aaaaaacaggaattcccgggctatgaaccccggggggcaaaggccatgggccttgcctat
gccacctctcccataggcggctcccacatgcgcggcgatccagcctattttgagatcttt
ggcaccaccttttccatggatccattggccaccaagggaaaagccggtcccacaaaacga
attcaggatctgtccgccattgtggatgccgcaggcctgtgcatctttttcggtgccaga
atgctggcggagaaaaatgacaccatgtcccccacgggcatgctgacctacctgaacacc
gccacaggagcagactataccattgaagagttggtcatggcagcagagcgtattaccaat
gcagaacgtatgttccttgtaaatgaaggctttgaccgaaaggatgattccctgcccagg
cgaatcaccgacgaaccgctgccggcaggccctgccaaggggcagacctgcgatcttcaa
accatgctggatgactattacaaggtccagggctgggataacaatggtattcccacaaag
gcgacacttgagaaactgggtctgacctaa

DBGET integrated database retrieval system