KEGG   Desulfobacterium autotrophicum: HRM2_39870Help
Entry
HRM2_39870        CDS       T00861                                 

Gene name
smuG
Definition
protein SmuG
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dat03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4480026..4480754)
Genome map
AA seq 242 aa AA seqDB search
MKNTDKQILDAAIDLRRSVDRLIFSAPVKTVYNPLAYAWNPYAAYVRRYASSRKKILFLG
MNPGPWGMAQVGVPFGEIETVKTWLGIEAKIDKPENEHPRRPVTGFDCPKSEVSGRRLWG
LFRERFHTADAFFREHIVMNYCPLVFMADSGANITPDKIAKQERGPLFDLCDRHLERIVE
IFEPEWCIGIGNFAEKRLLSGVKASSVRVGRILHPSPASPAANQDWAGKATQQLVELGVW
RP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacacggacaaacaaattcttgatgccgccattgacctgcgcaggagcgtcgac
cggctgattttttcagctcctgtaaaaaccgtatataatccccttgcctatgcgtggaac
ccctacgctgcctacgtccgccggtatgcttcgtccagaaaaaaaattctctttctggga
atgaatcccgggccatgggggatggcgcaggtcggggtgccgtttggagagatcgaaacg
gtgaaaacctggctggggatagaggcgaagatcgataaaccggaaaatgaacatccccga
agacctgtgaccgggtttgactgccccaagtccgaggtgagcggaaggcgcctgtgggga
ctgttccgggagcggttccatacggcggatgcgttcttcagggaacacattgtcatgaac
tattgcccccttgtgttcatggcggactcaggtgcaaacatcacccctgacaaaattgca
aagcaggaaagaggcccgctctttgacctgtgtgacaggcatcttgagcggatcgttgaa
atttttgaacccgaatggtgcatcggcattggtaattttgccgaaaaacgtctgctctct
ggggttaaagcttcgtctgtcagggtcggccggatacttcatcccagccctgcaagccct
gctgcaaaccaggactgggcaggcaaggcaacacaacagcttgttgagctgggggtgtgg
cggccctga

DBGET integrated database retrieval system