KEGG   Desulfobacterium autotrophicum: HRM2_40580Help
Entry
HRM2_40580        CDS       T00861                                 

Gene name
algC
Definition
(GenBank) AlgC
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00010  Glycolysis / Gluconeogenesis
dat00030  Pentose phosphate pathway
dat00051  Fructose and mannose metabolism
dat00052  Galactose metabolism
dat00230  Purine metabolism
dat00500  Starch and sucrose metabolism
dat00520  Amino sugar and nucleotide sugar metabolism
dat00521  Streptomycin biosynthesis
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_40580 (algC)
   00030 Pentose phosphate pathway
    HRM2_40580 (algC)
   00051 Fructose and mannose metabolism
    HRM2_40580 (algC)
   00052 Galactose metabolism
    HRM2_40580 (algC)
   00500 Starch and sucrose metabolism
    HRM2_40580 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HRM2_40580 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HRM2_40580 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HRM2_40580 (algC)
Enzymes [BR:dat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HRM2_40580 (algC)
    5.4.2.8  phosphomannomutase
     HRM2_40580 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACN17115
UniProt: C0QC98
Position
complement(4567458..4568813)
Genome map
AA seq 451 aa AA seqDB search
MNPGIFREYDIRGIAGKEFVDEDVVKIGRAYGTLLDRDNNRRVVVGRDCRLTSDHYSVLF
IEGILSTGCDVIDIGVCPTPVLYFAIHHLNAQGGAMVTASHNPPEYNGFKLMNGPDSIHS
QGLQEVRRIIDSGVYVQGRGTIEISDALTPYMAYIQENVCLKRPLRIGVDAGNGTGGVTA
LPVLKGLGCEVHDLYCDMDGTFPNHGSDPTVKANMVELIDLVKAKKLDLGVGYDGDADRI
GVVDEHGNIIYGDQLMVIFAREILKRKPGATFISEVKCSMVMYNDIEQHGGRAIMWKTGH
SLIKKKMKEANAELAGEMSGHMFFKDRYFGFDDALYATCRLLEIVADTGRTVSQLIEDLP
VTFTTPEIRVECDDSRKFDVVAAITEQFKKTHEVIDIDGMRALFGDGWGLVRASNTQPAL
VLRFEALTQQRLVEIRSMVETALEKIISKTP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgggaattttcagggagtacgatatccggggaattgcaggcaaggagtttgtg
gatgaagatgtggtcaaaattggtcgggcctatggcaccctccttgaccgggacaacaat
cgacgggtggttgtgggccgggattgcagattaacttccgatcattattccgtcctcttt
atcgagggtatcctttcaaccggatgtgatgtcattgatattggtgtctgtcccacgccc
gtgctctactttgccatccaccacctcaacgcccagggtggtgccatggtgactgccagc
cacaacccgcccgagtataacggattcaagctcatgaacgggcctgacagtatccacagc
cagggactccaggaggtgagacggatcatcgactcgggcgtatatgtacagggacgggga
accattgaaatcagcgatgccctcaccccctacatggcctatattcaggagaatgtctgc
ctgaaacgaccccttcgcatcggcgttgatgcgggcaatggcacgggcggcgtcacggcc
ctgccggtcctcaaaggtctgggatgtgaggtccatgacctttactgcgacatggacggc
acttttcccaaccacggttcagatcccacggtcaaggccaacatggttgaactcattgac
cttgtcaaagcaaaaaaactggatctgggcgtcgggtatgacggggatgccgaccgcatc
ggcgtagtcgacgagcacgggaacatcatctacggggatcagctcatggtaatctttgcc
agggagattctcaagcgcaaacccggggctacctttatttctgaggtcaagtgctccatg
gtcatgtacaatgacattgaacaacacgggggccgggccatcatgtggaagacgggccat
tccctgatcaagaagaagatgaaagaggcgaatgccgaacttgcaggtgagatgagcggc
cacatgttctttaaggatcggtatttcggttttgacgacgccctctacgccacttgcagg
cttcttgagattgttgctgatacgggcaggaccgtatcccagctgattgaagatcttccc
gtcacctttaccacccctgagattcgggttgaatgtgacgattccagaaaatttgacgta
gttgccgccattacagagcagtttaaaaagacccacgaggtcattgacattgatggcatg
cgggcgctctttggcgacggctgggggcttgtgcgggcctccaacacccagcctgccctg
gtgttgcggtttgaggcattaacacaacaaaggcttgttgagatcagatccatggttgag
acggcccttgaaaagatcatttccaagacaccctaa

DBGET integrated database retrieval system