KEGG   Desulfobacterium autotrophicum: HRM2_40580Help
Entry
HRM2_40580        CDS       T00861                                 

Gene name
algC
Definition
protein AlgC (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_40580 (algC)
   00030 Pentose phosphate pathway
    HRM2_40580 (algC)
   00051 Fructose and mannose metabolism
    HRM2_40580 (algC)
   00052 Galactose metabolism
    HRM2_40580 (algC)
   00500 Starch and sucrose metabolism
    HRM2_40580 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HRM2_40580 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HRM2_40580 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HRM2_40580 (algC)
Enzymes [BR:dat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HRM2_40580 (algC)
    5.4.2.8  phosphomannomutase
     HRM2_40580 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4567458..4568813)
Genome map
AA seq 451 aa AA seqDB search
MNPGIFREYDIRGIAGKEFVDEDVVKIGRAYGTLLDRDNNRRVVVGRDCRLTSDHYSVLF
IEGILSTGCDVIDIGVCPTPVLYFAIHHLNAQGGAMVTASHNPPEYNGFKLMNGPDSIHS
QGLQEVRRIIDSGVYVQGRGTIEISDALTPYMAYIQENVCLKRPLRIGVDAGNGTGGVTA
LPVLKGLGCEVHDLYCDMDGTFPNHGSDPTVKANMVELIDLVKAKKLDLGVGYDGDADRI
GVVDEHGNIIYGDQLMVIFAREILKRKPGATFISEVKCSMVMYNDIEQHGGRAIMWKTGH
SLIKKKMKEANAELAGEMSGHMFFKDRYFGFDDALYATCRLLEIVADTGRTVSQLIEDLP
VTFTTPEIRVECDDSRKFDVVAAITEQFKKTHEVIDIDGMRALFGDGWGLVRASNTQPAL
VLRFEALTQQRLVEIRSMVETALEKIISKTP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgggaattttcagggagtacgatatccggggaattgcaggcaaggagtttgtg
gatgaagatgtggtcaaaattggtcgggcctatggcaccctccttgaccgggacaacaat
cgacgggtggttgtgggccgggattgcagattaacttccgatcattattccgtcctcttt
atcgagggtatcctttcaaccggatgtgatgtcattgatattggtgtctgtcccacgccc
gtgctctactttgccatccaccacctcaacgcccagggtggtgccatggtgactgccagc
cacaacccgcccgagtataacggattcaagctcatgaacgggcctgacagtatccacagc
cagggactccaggaggtgagacggatcatcgactcgggcgtatatgtacagggacgggga
accattgaaatcagcgatgccctcaccccctacatggcctatattcaggagaatgtctgc
ctgaaacgaccccttcgcatcggcgttgatgcgggcaatggcacgggcggcgtcacggcc
ctgccggtcctcaaaggtctgggatgtgaggtccatgacctttactgcgacatggacggc
acttttcccaaccacggttcagatcccacggtcaaggccaacatggttgaactcattgac
cttgtcaaagcaaaaaaactggatctgggcgtcgggtatgacggggatgccgaccgcatc
ggcgtagtcgacgagcacgggaacatcatctacggggatcagctcatggtaatctttgcc
agggagattctcaagcgcaaacccggggctacctttatttctgaggtcaagtgctccatg
gtcatgtacaatgacattgaacaacacgggggccgggccatcatgtggaagacgggccat
tccctgatcaagaagaagatgaaagaggcgaatgccgaacttgcaggtgagatgagcggc
cacatgttctttaaggatcggtatttcggttttgacgacgccctctacgccacttgcagg
cttcttgagattgttgctgatacgggcaggaccgtatcccagctgattgaagatcttccc
gtcacctttaccacccctgagattcgggttgaatgtgacgattccagaaaatttgacgta
gttgccgccattacagagcagtttaaaaagacccacgaggtcattgacattgatggcatg
cgggcgctctttggcgacggctgggggcttgtgcgggcctccaacacccagcctgccctg
gtgttgcggtttgaggcattaacacaacaaaggcttgttgagatcagatccatggttgag
acggcccttgaaaagatcatttccaagacaccctaa

DBGET integrated database retrieval system