KEGG   Desulfobacterium autotrophicum: HRM2_42150Help
Entry
HRM2_42150        CDS       T00861                                 

Gene name
caiD2
Definition
(RefSeq) protein CaiD2 (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    HRM2_42150 (caiD2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HRM2_42150 (caiD2)
   00650 Butanoate metabolism
    HRM2_42150 (caiD2)
  Lipid metabolism
   00071 Fatty acid degradation
    HRM2_42150 (caiD2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HRM2_42150 (caiD2)
   00310 Lysine degradation
    HRM2_42150 (caiD2)
   00360 Phenylalanine metabolism
    HRM2_42150 (caiD2)
   00380 Tryptophan metabolism
    HRM2_42150 (caiD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HRM2_42150 (caiD2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HRM2_42150 (caiD2)
   00281 Geraniol degradation
    HRM2_42150 (caiD2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HRM2_42150 (caiD2)
   00627 Aminobenzoate degradation
    HRM2_42150 (caiD2)
   00930 Caprolactam degradation
    HRM2_42150 (caiD2)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HRM2_42150 (caiD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4727830..4728651
Genome map
AA seq 273 aa AA seqDB search
MNQYEFYLVEKRPPLAWVFLNRPEKKNAMGPAAWKESEAVFNDLDNDPDIRAVVIAGKGP
SFCVGIDLMGMVGELPELMDNEQKGGIKWKLLPKIKHLQTAISAVERCRKPVIAAIHGHC
IGAGLDLATACDIRICSKDATFSLREAAVGFVADVGVLQRIPAIVGQGHARELAFTAKDI
SADRAKQILLVNHVYDTEENLMANAAILAREIADNSPLAVQASKDVLNFCVGKTVQEGLD
YVASMSANIIPSNDLMEALTAFSERRKPKFTGV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatatgaattttatcttgtggaaaaacgccccccccttgcctgggtctttctc
aaccggcctgaaaagaaaaatgccatgggacctgccgcctggaaggaatccgaggctgtt
ttcaacgatcttgacaatgatcctgacatccgggccgttgttattgcaggcaagggaccc
agcttctgtgtgggcatagacctcatgggcatggtgggcgaacttccagaactcatggac
aacgagcaaaagggtggaatcaaatggaaactgctgccaaagatcaagcatctccagacc
gccatctctgcggttgaacgttgcagaaaacctgtcatcgcagcaatccacggccattgc
atcggcgcaggccttgatcttgcgacggcctgcgatatcaggatctgttctaaggatgcc
accttttccctgcgggaagctgccgtgggatttgtcgccgacgttggggtcctccagcgc
ataccggccattgtgggccagggccatgcacgggaacttgcctttaccgcaaaggacatt
tcggccgacagggcaaaacagatccttcttgttaaccatgtctatgacacagaggaaaac
ctgatggcaaatgccgcaattcttgcccgggaaattgccgacaactctccccttgccgtc
caggcatccaaggatgttctcaacttctgcgttggtaaaaccgttcaggagggtcttgac
tatgttgcctccatgagcgccaacatcattccgtccaacgatctcatggaggccctcacg
gcctttagcgaacgacgcaaacccaaattcacaggtgtctga

DBGET integrated database retrieval system