KEGG   Desulfobacterium autotrophicum: HRM2_42150Help
Entry
HRM2_42150        CDS       T00861                                 

Gene name
caiD2
Definition
(GenBank) CaiD2
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00071  Fatty acid degradation
dat00280  Valine, leucine and isoleucine degradation
dat00281  Geraniol degradation
dat00310  Lysine degradation
dat00360  Phenylalanine metabolism
dat00362  Benzoate degradation
dat00380  Tryptophan metabolism
dat00410  beta-Alanine metabolism
dat00627  Aminobenzoate degradation
dat00640  Propanoate metabolism
dat00650  Butanoate metabolism
dat00903  Limonene and pinene degradation
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01212  Fatty acid metabolism
Module
dat_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HRM2_42150 (caiD2)
   00650 Butanoate metabolism
    HRM2_42150 (caiD2)
  Lipid metabolism
   00071 Fatty acid degradation
    HRM2_42150 (caiD2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HRM2_42150 (caiD2)
   00310 Lysine degradation
    HRM2_42150 (caiD2)
   00360 Phenylalanine metabolism
    HRM2_42150 (caiD2)
   00380 Tryptophan metabolism
    HRM2_42150 (caiD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HRM2_42150 (caiD2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HRM2_42150 (caiD2)
   00281 Geraniol degradation
    HRM2_42150 (caiD2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HRM2_42150 (caiD2)
   00627 Aminobenzoate degradation
    HRM2_42150 (caiD2)
   00930 Caprolactam degradation
    HRM2_42150 (caiD2)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HRM2_42150 (caiD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACN17271
UniProt: C0QD39
Position
4727830..4728651
Genome map
AA seq 273 aa AA seqDB search
MNQYEFYLVEKRPPLAWVFLNRPEKKNAMGPAAWKESEAVFNDLDNDPDIRAVVIAGKGP
SFCVGIDLMGMVGELPELMDNEQKGGIKWKLLPKIKHLQTAISAVERCRKPVIAAIHGHC
IGAGLDLATACDIRICSKDATFSLREAAVGFVADVGVLQRIPAIVGQGHARELAFTAKDI
SADRAKQILLVNHVYDTEENLMANAAILAREIADNSPLAVQASKDVLNFCVGKTVQEGLD
YVASMSANIIPSNDLMEALTAFSERRKPKFTGV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatatgaattttatcttgtggaaaaacgccccccccttgcctgggtctttctc
aaccggcctgaaaagaaaaatgccatgggacctgccgcctggaaggaatccgaggctgtt
ttcaacgatcttgacaatgatcctgacatccgggccgttgttattgcaggcaagggaccc
agcttctgtgtgggcatagacctcatgggcatggtgggcgaacttccagaactcatggac
aacgagcaaaagggtggaatcaaatggaaactgctgccaaagatcaagcatctccagacc
gccatctctgcggttgaacgttgcagaaaacctgtcatcgcagcaatccacggccattgc
atcggcgcaggccttgatcttgcgacggcctgcgatatcaggatctgttctaaggatgcc
accttttccctgcgggaagctgccgtgggatttgtcgccgacgttggggtcctccagcgc
ataccggccattgtgggccagggccatgcacgggaacttgcctttaccgcaaaggacatt
tcggccgacagggcaaaacagatccttcttgttaaccatgtctatgacacagaggaaaac
ctgatggcaaatgccgcaattcttgcccgggaaattgccgacaactctccccttgccgtc
caggcatccaaggatgttctcaacttctgcgttggtaaaaccgttcaggagggtcttgac
tatgttgcctccatgagcgccaacatcattccgtccaacgatctcatggaggccctcacg
gcctttagcgaacgacgcaaacccaaattcacaggtgtctga

DBGET integrated database retrieval system