KEGG   Desulfobacterium autotrophicum: HRM2_42540Help
Entry
HRM2_42540        CDS       T00861                                 

Gene name
gtaB
Definition
protein GtaB
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HRM2_42540 (gtaB)
   00052 Galactose metabolism
    HRM2_42540 (gtaB)
   00500 Starch and sucrose metabolism
    HRM2_42540 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    HRM2_42540 (gtaB)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HRM2_42540 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4765380..4766261
Genome map
AA seq 293 aa AA seqDB search
MKIRKAVFPVAGLGTRFLPATKAMAKEMLPVVDKPIIQYAVEEALNAGIEQIIFVTGRGK
NALENHFDHSYELELSLKHKEKNELLKQVEALVPETGTIIYTRQQEALGLGHAIWCARDI
VGDEPFAVLLADDMIQAKRPVLSQMIDHFDRLRASVVAVMEVDEDQTDKYGILDAEPIEE
NLVRIRGMIEKPKPADAPSNLAIIGRYILTPKIFHFLGKKQTGAGGEIQLTDAMEKLLEV
QPIFGYKFEGTRFDCGDKAGFQMANIAFAMERPEIREKLLTFIQKICQSQETT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaaaagcggtattccccgttgcagggctcggcacacgatttctgcccgcc
acaaaggccatggcaaaagagatgcttccggttgttgacaaacccatcatccagtatgcc
gtggaagaggccctgaatgcgggtatcgagcagatcatatttgtaacgggccggggcaaa
aatgccctggaaaaccactttgaccactcctatgaactggaactctccctgaaacacaaa
gaaaaaaatgagcttctcaagcaggtggaggccctggtgccagagacaggaaccatcatc
tacacccgccagcaagaagccctggggcttggccacgccatctggtgcgcaagggatatc
gtgggcgatgaaccctttgcagtgctccttgccgatgacatgatccaggcaaaacgtcct
gttctctcccagatgatcgatcactttgaccggctcagggcatcggttgtggccgtgatg
gaggtggacgaagatcagaccgataaatacggcattctggatgccgaacccattgaggaa
aatctggtaaggataaggggcatgattgaaaagccgaagccggcagacgcgccctcaaac
cttgccatcatcggccgctacatccttacccccaagatttttcatttccttggcaaaaag
cagaccggggccggtggagagatccagctcacagatgccatggagaaactccttgaagtc
caacccatctttggctataaatttgagggaacgcggtttgactgtggcgataaggcagga
tttcagatggcgaacattgcctttgccatggaacgccctgaaatccgcgagaaacttctg
acttttatccagaaaatatgccagtcccaggaaacaacgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system