KEGG   Desulfobacterium autotrophicum: HRM2_44080Help
Entry
HRM2_44080        CDS       T00861                                 

Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00030  Pentose phosphate pathway
dat01100  Metabolic pathways
dat01120  Microbial metabolism in diverse environments
dat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HRM2_44080
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HRM2_44080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N NCBP3 YgbA_NO
Motif
Other DBs
NCBI-ProteinID: ACN17464
UniProt: C0QEW3
Position
complement(4955726..4957585)
Genome map
AA seq 619 aa AA seqDB search
MMNHLGSIVHVDLSEKKVTIEPFGEKLARTVLGGFGFNTWYLYKNLPKNALALGPENILI
ISCGLLTGTAAPASSRSHVSAKSPLSGLMGSSSVGGHIGARLKSLGIAAMVIRGRSDLPV
SLVVDKTGVSFRTGEDLWGLSTRNTESVLRNERQGQNVEILSIGVAGENLVPFACIMNGT
DHAAGRTGMGAVMGSKNLKAILVAGVKNLEKSSPETKALVKAYIGKIKAGLPIYTDFSTT
GSSAHIQWLNDTGQLGTRNYQEGTMDGVEKIDGKNLLTYVEKKTSCHRCPVHCKAEIKIK
AGRHQGFHGGRPEYETVINMGSLCGLKDPDELLYLSNLANILGIDTISTGSIIAFAMELY
ERGIITTQDTGGLALTWGNAQAMEALMHQIALRKGFGKILSLGVKGAASVIGKGSEQYAY
HTKGVEIYGSDPRGSQAIALSYTVSLRGGDFTSVYPIPAFRYTQEKAQKEFGTTAIMEPH
IIDGKGILVRGCLLTSAIIDSLGLCKVPTLSIMADFTLENESDLIRAITGLELSAQELFY
RGEQLINMEKLFNLAHGASLENDNLPGLFQEKGLPHGPVKGLLVEDLSVMVQDFYTVMGW
DEAGIPTGETLKRLKLEEI
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccatctgggaagcattgtccatgtggacttgtcagaaaaaaaggtaaccatt
gaaccctttggggaaaaactggcccggaccgttttgggcggatttggattcaacacctgg
tacctctacaaaaacctgcccaaaaatgccctggcactgggtcctgaaaatatcctgatc
atcagttgcggcctgctcacgggtacggccgccccggcatcctcccggagccatgtcagc
gccaagtcgcccctgtctggactcatgggcagttccagtgtgggcggtcacatcggtgcc
cggttaaagtccctgggaattgccgccatggtgatccgcgggcgttcagatctaccggtc
tcgcttgtggtggataaaaccggtgtttcctttcgaaccggggaagatctttggggactt
tctacccgcaacactgaatccgttctgagaaatgaacgccagggccagaacgtggaaatt
ttatccattggggtggctggagaaaatttggttccctttgcctgcatcatgaacgggacg
gatcatgctgccggacggaccggcatgggtgcggtcatggggtccaagaaccttaaggcc
atcctggtggccggggtcaaaaacctggagaaatcctcccctgaaaccaaggccctggtc
aaggcgtatatcggcaaaatcaaagccgggcttcccatttacacggatttctccaccacc
ggcagttccgcccatatccagtggctcaacgataccggccagctgggaacccggaattat
caggaaggtaccatggacggggtagaaaaaatcgacggcaagaatcttctgacctatgtc
gaaaaaaaaaccagctgtcaccggtgcccggtgcattgcaaggctgaaatcaaaatcaaa
gccggccgtcaccagggattccatgggggtcgacccgaatatgagaccgtcatcaatatg
ggctctttgtgcggactgaaagatccggatgaactcttgtatctgtccaatctggccaat
atactggggatagataccatttccacagggtccatcattgcctttgccatggaactctat
gaacggggcatcatcaccacccaggataccgggggacttgcattaacctggggaaacgcc
caggcaatggaggcgctcatgcatcagattgccctgagaaaaggattcgggaaaattctt
tccctgggggtcaagggggctgccagcgtcatcggcaagggatccgaacaatatgcctac
cacaccaaaggggttgaaatttacgggtcagatcccaggggaagccaggccattgccctc
tcctatacggtttccctcaggggaggggattttaccagcgtatacccgattccggccttt
cgctacacccaggaaaaagcacaaaaagaatttggcaccacggcgattatggagccccat
atcatcgacggaaaggggattctggttcgaggctgtcttttgacttcggccataatcgat
tctctggggctttgcaaggtgccgaccctgtccattatggcagatttcaccctggaaaac
gaaagcgatctgatccgggccattaccggtctggaattgtccgcccaggagctgttttac
aggggggaacaactcatcaacatggaaaaactattcaaccttgcccacggtgcctccctg
gaaaacgacaacctgcccgggctatttcaggaaaaagggcttccccatgggccggtaaaa
ggtcttctggtggaggatctttcggtcatggttcaggatttctacacggtcatgggatgg
gacgaggcaggaattcccacgggtgaaaccctgaaacgccttaaactggaggaaatctaa

DBGET integrated database retrieval system