KEGG   Desulfobacterium autotrophicum: HRM2_45290Help
Entry
HRM2_45290        CDS       T00861                                 

Gene name
atoB5
Definition
(GenBank) AtoB5
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00071  Fatty acid degradation
dat00072  Synthesis and degradation of ketone bodies
dat00280  Valine, leucine and isoleucine degradation
dat00310  Lysine degradation
dat00362  Benzoate degradation
dat00380  Tryptophan metabolism
dat00620  Pyruvate metabolism
dat00630  Glyoxylate and dicarboxylate metabolism
dat00640  Propanoate metabolism
dat00650  Butanoate metabolism
dat00900  Terpenoid backbone biosynthesis
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
dat01212  Fatty acid metabolism
dat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HRM2_45290 (atoB5)
   00630 Glyoxylate and dicarboxylate metabolism
    HRM2_45290 (atoB5)
   00640 Propanoate metabolism
    HRM2_45290 (atoB5)
   00650 Butanoate metabolism
    HRM2_45290 (atoB5)
  Lipid metabolism
   00071 Fatty acid degradation
    HRM2_45290 (atoB5)
   00072 Synthesis and degradation of ketone bodies
    HRM2_45290 (atoB5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HRM2_45290 (atoB5)
   00310 Lysine degradation
    HRM2_45290 (atoB5)
   00380 Tryptophan metabolism
    HRM2_45290 (atoB5)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HRM2_45290 (atoB5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HRM2_45290 (atoB5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HRM2_45290 (atoB5)
Enzymes [BR:dat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HRM2_45290 (atoB5)
Exosome [BR:dat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HRM2_45290 (atoB5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: ACN17585
UniProt: C0QF84
Position
complement(5084781..5085962)
Genome map
AA seq 393 aa AA seqDB search
MRKVAIIGTGHTDFGFNSPKTGLELFCEAATEAMVEANVQPKDIQALYCGNGLSDFSEGQ
IMIQSYIADSLGCRHIPATRFEAACSSATVAIRDAYMWVASGFYDIVLVGGTEKATAMGT
ALATRTFAMGTDARYEFPAGLTFPGFFGLLANLYAKKYNIPFERLRNQMSLVSVQSHSYG
VKNPHAQFKKEITVDQVEKAFMVASPLTLLDCCPFSDGAAALVIASEEKARALCDTPIYI
AGVGQASSGMLSCQYKDIPRLKAREISVKQAYDMAGVGPQDIDVCELHDCFSIASIIAAE
GLGFAEFGKGGQLWEKEETRIGGKIPINISGGLKSKGHPIGATGASQTVEIVKQLRGDLV
GQERQVEGARVGLVDTLGGDGILCNLILKKERE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtagccattataggcacaggacacacggatttcgggtttaattcccccaag
acagggctggagcttttttgtgaagctgcaacggaagccatggttgaagccaatgtgcaa
ccaaaggatattcaggcgttatattgcggtaatgggctaagtgatttttctgaagggcag
attatgattcagtcgtatatcgccgattccctgggatgtcgtcatatcccggccacccgg
tttgaagcggcctgttcgtctgccacagtggccatacgtgacgcttatatgtgggtggca
tcgggcttttacgatattgtccttgtgggtggaacggaaaaggccacggccatgggaacg
gcccttgccacccggacctttgccatgggaaccgatgcccggtatgaattcccggcaggt
cttacctttcccggattctttggacttctggcaaatttatatgcaaaaaaatacaatatc
ccctttgaaagacttcggaatcaaatgtccctggtttcagtgcagtcccacagctatggg
gtcaagaatccccatgcccaattcaaaaaagagatcaccgtggatcaggtggaaaaggca
tttatggttgcatctccattgaccttgcttgattgctgtcccttttccgatggtgctgca
gcacttgttattgcatcggaagaaaaggccagggccctttgtgacactcccatctatatt
gccggggtggggcaggcatcttcgggtatgttaagctgtcagtacaaagatattccccgg
ttaaaagccagggagatttccgtaaaacaggcatatgacatggccggggtcggcccccaa
gacattgatgtgtgtgaactccacgattgcttcagcattgccagcatcatcgccgccgaa
ggtctgggatttgccgaatttggaaaaggcggccagctgtgggaaaaagaggaaacccgg
atcgggggtaaaattcccattaatatttcagggggactcaagtcaaagggacatcccatc
ggggcgacaggggcatcccagacggtggaaatcgtaaagcagctccggggggatcttgtg
gggcaggaaaggcaggtggaaggggccagggtgggactggtggataccctgggtggagat
ggcatcctctgcaatcttattttaaaaaaggaaagagaataa

DBGET integrated database retrieval system