KEGG   Desulfobacterium autotrophicum: HRM2_45560Help
Entry
HRM2_45560        CDS       T00861                                 

Gene name
hisD2
Definition
protein HisD2 (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HRM2_45560 (hisD2)
  Amino acid metabolism
   00340 Histidine metabolism
    HRM2_45560 (hisD2)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HRM2_45560 (hisD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5123372..5124670
Genome map
AA seq 432 aa AA seqDB search
MKIYTYPSPEGEQRICDTLKRGLGFTPENQRAVEAYIEDVRTRGDQALVEYTNQFDSSQV
TRDTLKVSQQEIEEAKTLVDSDFSRALDRAVDQLGTFHSRQRQNSWIDTPRNGVMVGQMV
NPVDAAGIYAPGAKGGKTPLVSSVLMGGIPARVAGVKSCCLMTPPMENGKINPYMLVAAD
RVGINAIFKAGSAWAIAALAFGTESVPKVDVIVGPGNIFVTLAKKIVSGIVGIDMIAGPS
EILIIADKGANPDHIAADLLSQAEHDPMASAILVTDSMEMATRTKAALEIQVKALGRRQI
AQRSIDDFGAIMKVPDIDTAIALANRLAPEHLELIVDNPFDQVGKIKNAGAVFLGPYTPE
PMGDYIAGPNHVLPTAGTARFSSALGVDNFTKRTSLINYSKEAFDREAQDVMVLANIEGL
GAHANSVRIRTK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttacacctacccctcccctgagggggaacaacgtatttgtgacaccctgaag
cggggccttggatttacccctgaaaaccagagggccgttgaagcctatatcgaagatgtc
agaacaaggggagaccaggccctggtcgaatacaccaatcaatttgactcttcccaggtg
acccgtgacaccctgaaggtcagccagcaggagatcgaagaggcaaagaccctggtggat
tctgatttttcaagggcccttgaccgggccgtggaccaacttggaactttccactcaagg
caacgccagaattcgtggatcgacacccccagaaacggggtcatggtcggccagatggtt
aaccctgtggatgcggccggcatttatgcccccggggcaaagggcggaaaaacccccctg
gtcagttccgttctcatggggggcattcctgccagggtggcaggcgtaaaatcatgctgt
ctcatgacaccgcccatggaaaacggcaagataaacccctacatgctggttgcggcagac
cgggtgggaatcaacgccatctttaaggccggaagcgcctgggccattgctgcccttgcc
tttggcaccgaatccgtgcccaaggtggatgtgatcgtgggaccaggtaacatctttgtc
accctggccaaaaaaatcgtgtcaggaattgtcggcattgatatgatagcgggtccgagc
gagatccttattattgcagacaagggtgccaatccagaccatattgcggccgaccttctt
tcccaggccgagcacgaccccatggcgtcggccatccttgtcaccgattccatggaaatg
gcaacccggacaaaggcggccctggagatccaggtcaaagccctgggccgcagacagatc
gcccagcggtccattgatgactttggtgccatcatgaaggttccagacattgatacggca
atcgcccttgccaaccgccttgcccctgagcacctggaactcattgttgataaccccttt
gaccaggtgggaaagatcaaaaacgcaggcgctgttttccttggcccctacaccccggag
cccatgggagattacattgcagggcctaaccatgtgctgcccactgccggtacggccagg
ttctcatcggccctgggcgtggataatttcaccaaacgaaccagcctgatcaattattca
aaggaggcctttgaccgtgaggcccaggatgtgatggtcctggccaatattgaggggctt
ggagcccatgcaaactcggtccgcatcaggacaaaataa

DBGET integrated database retrieval system