KEGG   Desulfobacterium autotrophicum: HRM2_49370Help
Entry
HRM2_49370        CDS       T00861                                 

Gene name
recD3
Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dat03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5574603..5576804)
Genome map
AA seq 733 aa AA seqDB search
MDSATAAGVFKRTMIVLQGTLERITFRNEENHYTIAKIKTRETRDAVVVVGTMPGVNEGE
TLKLTGQWVAHPKYGDQFKVDRFEVTLPATVAGIRRYLGSGIIKGIGMAMAKRIVEQFEE
RSLEVIENEPERLREIPGIGKSKADLITRAWDKHHAVRKVMRFLQDHDVGIAHASAILKY
YGTDSLNILKHNPYSVSKDVPEAGFEVADAIALKAGFKPDDPERIKACLLFLLCKKECDG
HVFAEFEALNLGCESLTGAGREDVEKALGALADAGEVVVEQDQVYLKRLHMAEKGIAERI
RAMLCVPINPVDLSDEAITMEVATRLAVKLSQEQIDVVKQVMAHRVVVITGGPGTGKTTL
IRAVCAVLKKLRKTVTLAAPTGRAARRLSQVTDKKASTLHRLLLCDPDTGEFARNLSNPL
DSDVVIVDEASMVDTMLMFNLLLAVPVNSSLILVGDIFQLPSVGPGNVLSDIIASKAVKT
FSLTRIFRQAEQSPIVMNAHAIRNGEMPCLENSSDGLSEFYFIESASPERVVATIVELCS
NRIKKAFPHVDEIQVLTPMHKGEAGTINLNQKLQQVLNKAAGGIEARGLTFKTGDKVMHL
KNNYQKEVFNGDIGIVHEVVKSEGRLSVDYDGRVVDYDLLELDELTLAYAVSVHKSQGSE
YSAVVIAMTVQHYPLLQRNLLYTAMTRGKNLVIVVGSRRSMEIALHNNRTDCRLSGLCRR
LEMPEMDSRGVES
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggattctgcaacagcagcaggggtctttaaaagaaccatgatcgttctccagggaacc
cttgagcggatcacctttcgcaacgaggaaaatcactataccatcgcaaaaataaagacc
cgggagacccgggacgccgttgtggtggtgggtaccatgcccggggtcaatgaaggagaa
acccttaaacttacggggcagtgggtggcccatcccaagtatggagatcagtttaaggtc
gaccggtttgaggttacactccctgcaaccgtcgcaggcatcagacgctatctgggctcc
gggatcatcaagggcattggcatggccatggccaaacggattgtagagcagtttgaggaa
cgttcccttgaggtcattgaaaacgagcccgaacgactcagggaaattccagggattgga
aaatcaaaggccgacctgatcaccagggcctgggacaagcaccacgccgtcagaaaggtg
atgcgttttctccaggaccatgacgtgggaattgcccatgcatcggccattctgaaatac
tatggcaccgacagcctcaatatcctcaagcataacccctactccgtatcaaaggacgtt
cctgaggcaggttttgaggtggcggacgccattgcccttaaggccggttttaaaccggat
gatcctgaacggatcaaggcctgcctcttgtttctcctgtgcaaaaaagagtgcgacggc
cacgtgtttgcagaatttgaggcattgaatctgggctgtgagtcactcaccggggcaggc
agggaagatgttgaaaaggccctgggggccctggccgatgccggcgaggttgttgtggaa
caggatcaggtttatctcaagcgactccacatggcggaaaagggaattgctgaaaggata
cgggcaatgctttgtgtgcccattaatcctgttgacctttccgacgaagccatcaccatg
gaggtggccacaaggcttgctgtaaagctttcccaggagcagattgatgtagtaaaacag
gtgatggcccaccgggtggtggtcataacgggtgggccgggaacgggaaagaccaccctg
atccgggctgtttgtgctgttttgaaaaaacttcgcaaaaccgtgacccttgccgctccc
acgggcagggccgcaagaaggctctcccaggtgacagataaaaaggcatccaccctccat
cgcctgctgctgtgtgatcccgacaccggggagtttgcaaggaatctgtccaaccccctt
gattcggacgtggtcatcgttgatgaggcatccatggtggacaccatgctcatgtttaat
cttcttctggccgtgcctgtaaattcaagtcttattctggtgggggatatatttcagctt
ccttcggtggggccgggcaatgtgctctccgacatcattgcatccaaggcggtcaagacc
ttcagcctgacccggattttcaggcaggcggaacagagccccattgtcatgaacgcccac
gccatccggaacggtgaaatgccctgccttgagaacagctcagacgggctgtcagagttt
tatttcatcgagagcgcctcgccggaacgggtggtggcaaccattgtggagctgtgcagc
aaccgcatcaaaaaggcctttccccatgtggacgaaatccaggtgctgacccccatgcac
aagggcgaggctggaaccatcaatctcaaccagaagctgcagcaggtgctcaacaaggct
gccggcggcattgaggcaaggggattgaccttcaagaccggcgataaggtgatgcacctg
aagaacaactaccagaaagaggtgttcaacggcgatatcggcattgtccacgaggtggtg
aaatcagagggaaggttgtccgtggactatgacggacgggtggtggactatgacctgctc
gagcttgatgagctgacccttgcctatgccgtgtcggtccacaaatcccaggggtcggaa
tactcggccgtggtcattgccatgacggttcagcactatccccttctccagagaaatctg
ctgtacacggccatgacccgggggaaaaatcttgtcattgtggtgggatcaagaagatcc
atggagattgccctgcacaacaaccgcaccgattgcaggctttccggactctgcagacgg
ctggaaatgccggagatggattcacgtggggttgaatcttga

DBGET integrated database retrieval system