KEGG   Desulfobacterium autotrophicum: HRM2_49370Help
Entry
HRM2_49370        CDS       T00861                                 

Gene name
recD3
Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HRM2_49370 (recD3)
Enzymes [BR:dat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HRM2_49370 (recD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5574603..5576804)
Genome map
AA seq 733 aa AA seqDB search
MDSATAAGVFKRTMIVLQGTLERITFRNEENHYTIAKIKTRETRDAVVVVGTMPGVNEGE
TLKLTGQWVAHPKYGDQFKVDRFEVTLPATVAGIRRYLGSGIIKGIGMAMAKRIVEQFEE
RSLEVIENEPERLREIPGIGKSKADLITRAWDKHHAVRKVMRFLQDHDVGIAHASAILKY
YGTDSLNILKHNPYSVSKDVPEAGFEVADAIALKAGFKPDDPERIKACLLFLLCKKECDG
HVFAEFEALNLGCESLTGAGREDVEKALGALADAGEVVVEQDQVYLKRLHMAEKGIAERI
RAMLCVPINPVDLSDEAITMEVATRLAVKLSQEQIDVVKQVMAHRVVVITGGPGTGKTTL
IRAVCAVLKKLRKTVTLAAPTGRAARRLSQVTDKKASTLHRLLLCDPDTGEFARNLSNPL
DSDVVIVDEASMVDTMLMFNLLLAVPVNSSLILVGDIFQLPSVGPGNVLSDIIASKAVKT
FSLTRIFRQAEQSPIVMNAHAIRNGEMPCLENSSDGLSEFYFIESASPERVVATIVELCS
NRIKKAFPHVDEIQVLTPMHKGEAGTINLNQKLQQVLNKAAGGIEARGLTFKTGDKVMHL
KNNYQKEVFNGDIGIVHEVVKSEGRLSVDYDGRVVDYDLLELDELTLAYAVSVHKSQGSE
YSAVVIAMTVQHYPLLQRNLLYTAMTRGKNLVIVVGSRRSMEIALHNNRTDCRLSGLCRR
LEMPEMDSRGVES
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggattctgcaacagcagcaggggtctttaaaagaaccatgatcgttctccagggaacc
cttgagcggatcacctttcgcaacgaggaaaatcactataccatcgcaaaaataaagacc
cgggagacccgggacgccgttgtggtggtgggtaccatgcccggggtcaatgaaggagaa
acccttaaacttacggggcagtgggtggcccatcccaagtatggagatcagtttaaggtc
gaccggtttgaggttacactccctgcaaccgtcgcaggcatcagacgctatctgggctcc
gggatcatcaagggcattggcatggccatggccaaacggattgtagagcagtttgaggaa
cgttcccttgaggtcattgaaaacgagcccgaacgactcagggaaattccagggattgga
aaatcaaaggccgacctgatcaccagggcctgggacaagcaccacgccgtcagaaaggtg
atgcgttttctccaggaccatgacgtgggaattgcccatgcatcggccattctgaaatac
tatggcaccgacagcctcaatatcctcaagcataacccctactccgtatcaaaggacgtt
cctgaggcaggttttgaggtggcggacgccattgcccttaaggccggttttaaaccggat
gatcctgaacggatcaaggcctgcctcttgtttctcctgtgcaaaaaagagtgcgacggc
cacgtgtttgcagaatttgaggcattgaatctgggctgtgagtcactcaccggggcaggc
agggaagatgttgaaaaggccctgggggccctggccgatgccggcgaggttgttgtggaa
caggatcaggtttatctcaagcgactccacatggcggaaaagggaattgctgaaaggata
cgggcaatgctttgtgtgcccattaatcctgttgacctttccgacgaagccatcaccatg
gaggtggccacaaggcttgctgtaaagctttcccaggagcagattgatgtagtaaaacag
gtgatggcccaccgggtggtggtcataacgggtgggccgggaacgggaaagaccaccctg
atccgggctgtttgtgctgttttgaaaaaacttcgcaaaaccgtgacccttgccgctccc
acgggcagggccgcaagaaggctctcccaggtgacagataaaaaggcatccaccctccat
cgcctgctgctgtgtgatcccgacaccggggagtttgcaaggaatctgtccaaccccctt
gattcggacgtggtcatcgttgatgaggcatccatggtggacaccatgctcatgtttaat
cttcttctggccgtgcctgtaaattcaagtcttattctggtgggggatatatttcagctt
ccttcggtggggccgggcaatgtgctctccgacatcattgcatccaaggcggtcaagacc
ttcagcctgacccggattttcaggcaggcggaacagagccccattgtcatgaacgcccac
gccatccggaacggtgaaatgccctgccttgagaacagctcagacgggctgtcagagttt
tatttcatcgagagcgcctcgccggaacgggtggtggcaaccattgtggagctgtgcagc
aaccgcatcaaaaaggcctttccccatgtggacgaaatccaggtgctgacccccatgcac
aagggcgaggctggaaccatcaatctcaaccagaagctgcagcaggtgctcaacaaggct
gccggcggcattgaggcaaggggattgaccttcaagaccggcgataaggtgatgcacctg
aagaacaactaccagaaagaggtgttcaacggcgatatcggcattgtccacgaggtggtg
aaatcagagggaaggttgtccgtggactatgacggacgggtggtggactatgacctgctc
gagcttgatgagctgacccttgcctatgccgtgtcggtccacaaatcccaggggtcggaa
tactcggccgtggtcattgccatgacggttcagcactatccccttctccagagaaatctg
ctgtacacggccatgacccgggggaaaaatcttgtcattgtggtgggatcaagaagatcc
atggagattgccctgcacaacaaccgcaccgattgcaggctttccggactctgcagacgg
ctggaaatgccggagatggattcacgtggggttgaatcttga

DBGET integrated database retrieval system