KEGG   Desulfobacterium autotrophicum: HRM2_p00420Help
Entry
HRM2_p00420       CDS       T00861                                 

Definition
putative DEAD/DEAH box helicase, Type III restriction enzyme (subunit)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dat  Desulfobacterium autotrophicum
Brite
Enzymes [BR:dat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HRM2_p00420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHRM2a:41650..42120
Genome map
AA seq 156 aa AA seqDB search
MKIQFDPNLDFQKQAIESVAGVFEGQEICQTNFTVAPLQYTTQQVIPGMENNLGIGNRLK
LLDEDIHKNIRKIQLKNGLAPSEKMDSMDFTVEMETGTGKTYVYLRSIFEMNRLYGFTKF
IIVVPSIAIKGIFARPPKKYILKINRDFRDNCIRWL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacaatttgatccgaatctggacttccagaaacaggccatagaatccgttgcc
ggtgtatttgaagggcaggaaatctgtcagaccaattttaccgttgctccgctgcaatac
accacccagcaggttattcccgggatggaaaacaatctgggtataggaaaccgcttgaaa
ctgttggatgaggatattcataaaaacatccgcaagattcagctgaaaaatgggctggct
ccttccgaaaaaatggattccatggattttaccgtggagatggagaccgggactgggaaa
acctatgtctatctgcgctcgatctttgaaatgaaccggctctacggattcaccaagttt
attattgtggtgccctctatcgccattaagggtatttttgcacgacccccaaaaaagtat
attttgaagattaaccgtgattttcgagataactgtatacgctggctttga

DBGET integrated database retrieval system