KEGG   Candidatus Desulforudis audaxviator: Daud_0033Help
Entry
Daud_0033         CDS       T00655                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
40842..41438
Genome map
AA seq 198 aa AA seqDB search
MQYSRSVGRLIEELARLPGIGPKTAQRLAFHLVTAPREAAESLSRAILEARDKLVFCRVC
ANIADENPCGICRDQNRDHGLICVVERPRDVLAVEKAHGYRGLYHVLNGSLSPLQGVGPE
ELNIAALVTRVREGTVREVIVATNATVEGEATALYLARLLRPLNVRVTRLAFGLPVGSDL
EYADGRTLARAIEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtattcccgttcggtgggccgcctgatcgaggaactggccaggctaccggggatc
ggcccgaaaacggcgcagaggctggcttttcacctggtcactgcgccgcgggaggcggcc
gagagcttgagccgggctattctggaagcccgcgacaaactggtgttctgccgggtgtgc
gccaacatcgccgatgagaacccgtgcggcatctgccgtgatcagaaccgtgaccacggt
ctgatctgcgtggttgaacggccccgcgacgtcctggccgtcgaaaaggcgcacggctac
cggggactctaccacgttctgaacggcagcctgtcgccgctgcagggcgtgggccccgag
gagctgaacatcgcggccctggtaacgcgggtccgggaaggtaccgtccgggaagtgatc
gtggccaccaacgccaccgtggagggcgaggccacggccctgtacctggcccggctgctc
cgtcccctgaacgtccgggttacccggctggcttttgggctgccggtgggttccgacctg
gagtatgccgacggccggactttggcccgggccatcgagggtcggcgagaggtataa

DBGET integrated database retrieval system