KEGG   Candidatus Desulforudis audaxviator: Daud_0058Help
Entry
Daud_0058         CDS       T00655                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dau00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
62797..63717
Genome map
AA seq 306 aa AA seqDB search
MRAVQFISQAAGRLRLQWGDYPMRLSAYAKINLVLAVGGLRPDGYHEVETVLQQLELHDR
LELRQAEQFTLYTDSAEVPHGPGNLVWEAAALLRERFRCPFGADIRLYKSIPVAAGLGGG
SADAAATLVGLNELWNLNLDLETLLGLAAELGSDVPFFLVGPTALARGRGEILAPLPPAP
EMGVVLVTPAFGVRAAEAYAHFDRLPGGAPPDLTPVLRALAEKDRYAVAQGLFNGLEAAV
FDLYPEVRALKKELGKEEGVLGALVSGSGPTVFGLTADVEQAEVVAARLRSRGLPARATK
TRGPSS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgtacaattcattagtcaagccgcagggcgtttaaggcttcaatggggggac
tatccgatgcgtctctcggcctatgccaagattaacctggtactggccgtgggcggcctt
cgtcccgacggctaccacgaagtggagaccgtcctgcagcaactggaactgcatgaccgg
ctggagttgcggcaagccgagcaatttaccctgtacaccgacagcgcggaggtgcctcat
ggccccgggaacctggtctgggaggcggccgcgctgttgcgggaacgtttccgttgtccg
ttcggggccgacatccggttgtacaagtccatcccggtggccgccggtctgggcggcggt
tcagcggatgccgccgccaccctcgtgggattgaacgaactctggaacctgaatctggat
cttgagacgttactcggcctcgcggccgaactcggttccgatgtgccgttttttctggtt
gggccgaccgccctggcccgggggcggggggagattcttgcccctctgccgccggccccg
gagatgggggtggtgctggtcacgccggctttcggtgtacgggcggcggaagcctacgct
cactttgaccgccttcccggcggcgcacccccggatctgactccggtactccgggctctg
gccgaaaaagaccggtacgctgtggcccaggggctgttcaatggattggaggcggccgtc
ttcgacctataccctgaagtccgcgcgttgaaaaaagagctcggcaaagaagagggggtg
ctgggggcgttggtgtccggcagcggcccgacggtgttcggactgaccgcggacgtggag
caggcggaggttgtggccgccaggcttcgctcccggggacttccggcacgggcgacaaaa
acgcgcgggccctcgagttga

DBGET integrated database retrieval system