KEGG   Candidatus Desulforudis audaxviator: Daud_0095Help
Entry
Daud_0095         CDS       T00655                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daud_0095
Enzymes [BR:dau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Daud_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
100543..101733
Genome map
AA seq 396 aa AA seqDB search
MTHRVWVLEVNSLGEAKSAVAGVGADKTGCALMAPKAVHRVLRITGLTPVQANIIKQEML
ACGGEAAVARGTINHSVAETDALLMGTSKQFGAFLKKLRMQPFGLAALADKIERVLDNYE
TKPRGLDCRGKSLPLGERTLVMGILNVTPDSFSDGGAYLDPEAALERAREMAGHGADLID
LGGESTRPGAEPVGVEEELSRVMAVLPRLTRELDIPVSVDTSKTPVARAALEAGAHLVND
QWALADEGMAELVARYRVPVVLMHNQRGTEYRDLVGDITAYFEERLEKAKRAGIAPGQII
LDPGFGFGKTPVQNLTVLRRLREFTGLGFPLLIGTSRKSTIGKVLDLPVGERLEGTAATV
AVGICRGADIVRVHDVREMVRVARMTDAIVRGGGDQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaccgggtctgggtcctggaggtaaacagcctgggggaagcgaaaagcgcagtg
gccggagtcggcgcggataaaaccgggtgcgccctgatggcacccaaggcggtgcaccgc
gtgctccgcatcaccggcttaaccccggttcaggcgaacattatcaagcaggaaatgctg
gcctgcggcggcgaggccgccgtcgcccgggggacgataaaccactcggtggccgaaacc
gacgcgctgctgatgggcacctcaaaacagttcggcgctttcctgaaaaaactgcgcatg
cagccgttcggcctggccgctctggccgacaagattgagcgggtgctggacaactatgag
accaagccccgcgggctggactgccggggaaagtccctgccgctgggggaacgcaccctg
gtgatgggcattctaaacgtcaccccggactctttttcggacgggggtgcatacctggac
ccggaggcggcgctcgaacgggcccgggaaatggcggggcacggcgccgatctgatcgac
ctcggtggtgaatccacccggcccggcgccgagccggtcggcgtggaggaggagctttcc
cgggtgatggcggttctgccgcggctgacccgggaactggatattcccgtatccgtcgac
accagcaaaaccccggtggcccgcgcggcgctggaggccggcgcgcacctggtgaacgac
cagtgggcgctcgcggacgaagggatggcggaactcgtggcccgctaccgcgtaccggtg
gtcctgatgcacaaccagcgcgggaccgaataccgggacctggtgggcgacatcaccgcg
tactttgaggaacgcctagagaaggcgaagcgggccggaattgcgcccggccagatcatc
ctcgacccaggtttcggcttcgggaaaacaccggtgcagaatctgaccgtactgcgccgc
ctgcgggaattcaccggtttagggttcccgctcttgatcggcacctcccgcaaatccacc
atcggcaaggtactggaccttccggttggtgagcgcctggagggtacggcggccacggtg
gctgtgggcatctgccggggggcggacatcgtgcgggtgcacgacgtgcgggagatggtc
cgggtcgccaggatgaccgacgccattgtccggggaggcggggaccaatga

DBGET integrated database retrieval system