KEGG   Candidatus Desulforudis audaxviator: Daud_0095Help
Entry
Daud_0095         CDS       T00655                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
100543..101733
Genome map
AA seq 396 aa AA seqDB search
MTHRVWVLEVNSLGEAKSAVAGVGADKTGCALMAPKAVHRVLRITGLTPVQANIIKQEML
ACGGEAAVARGTINHSVAETDALLMGTSKQFGAFLKKLRMQPFGLAALADKIERVLDNYE
TKPRGLDCRGKSLPLGERTLVMGILNVTPDSFSDGGAYLDPEAALERAREMAGHGADLID
LGGESTRPGAEPVGVEEELSRVMAVLPRLTRELDIPVSVDTSKTPVARAALEAGAHLVND
QWALADEGMAELVARYRVPVVLMHNQRGTEYRDLVGDITAYFEERLEKAKRAGIAPGQII
LDPGFGFGKTPVQNLTVLRRLREFTGLGFPLLIGTSRKSTIGKVLDLPVGERLEGTAATV
AVGICRGADIVRVHDVREMVRVARMTDAIVRGGGDQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaccgggtctgggtcctggaggtaaacagcctgggggaagcgaaaagcgcagtg
gccggagtcggcgcggataaaaccgggtgcgccctgatggcacccaaggcggtgcaccgc
gtgctccgcatcaccggcttaaccccggttcaggcgaacattatcaagcaggaaatgctg
gcctgcggcggcgaggccgccgtcgcccgggggacgataaaccactcggtggccgaaacc
gacgcgctgctgatgggcacctcaaaacagttcggcgctttcctgaaaaaactgcgcatg
cagccgttcggcctggccgctctggccgacaagattgagcgggtgctggacaactatgag
accaagccccgcgggctggactgccggggaaagtccctgccgctgggggaacgcaccctg
gtgatgggcattctaaacgtcaccccggactctttttcggacgggggtgcatacctggac
ccggaggcggcgctcgaacgggcccgggaaatggcggggcacggcgccgatctgatcgac
ctcggtggtgaatccacccggcccggcgccgagccggtcggcgtggaggaggagctttcc
cgggtgatggcggttctgccgcggctgacccgggaactggatattcccgtatccgtcgac
accagcaaaaccccggtggcccgcgcggcgctggaggccggcgcgcacctggtgaacgac
cagtgggcgctcgcggacgaagggatggcggaactcgtggcccgctaccgcgtaccggtg
gtcctgatgcacaaccagcgcgggaccgaataccgggacctggtgggcgacatcaccgcg
tactttgaggaacgcctagagaaggcgaagcgggccggaattgcgcccggccagatcatc
ctcgacccaggtttcggcttcgggaaaacaccggtgcagaatctgaccgtactgcgccgc
ctgcgggaattcaccggtttagggttcccgctcttgatcggcacctcccgcaaatccacc
atcggcaaggtactggaccttccggttggtgagcgcctggagggtacggcggccacggtg
gctgtgggcatctgccggggggcggacatcgtgcgggtgcacgacgtgcgggagatggtc
cgggtcgccaggatgaccgacgccattgtccggggaggcggggaccaatga

DBGET integrated database retrieval system