KEGG   Candidatus Desulforudis audaxviator: Daud_0135Help
Entry
Daud_0135         CDS       T00655                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dau01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dau00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
150441..152177
Genome map
AA seq 578 aa AA seqDB search
MPGERVLTILHLDLDRLTWKTETRADLAGYLGGIGLASKLFAELWRPGLKPLDPAQPVVL
AIGPLSTVFPLATKTAAVFHSPLTGEWGESYAGMRLALALRFAGYDALVVTGRAAHPVYA
SVTPGRVSFRDARGLWGLSTEETGRILREWEAGRGHRSTVRIGPAGERGVAFAGVNVDTF
RHFGRLGLGAVFGAKKLKALVVYGDKSFPIPDRKAYRAVYDEVFRRAVETDLLEKYHGLG
TAGNVMVLDGLGALPTRNLRQNRFEHAARISGEAFAEQTLLRKLACPGCPVGCIHIGLYR
RQFGTGYEYESIALAYDHELIYALGSLLGIGDTDGVYALIEKVELLGLDAITSGVLLAWA
TEALQEGLISAEELGVRLAFGKPDGYLAALDRVVRQPNDLYRTLARGLEAAARTYGGRDF
ALTLGGHEMAGYHTGYGFLLGQAVGARHSHLCNAGYAVDQDLGPDFDPDVLVERLIAEEK
WRQVLNSLCICLFGRGVWDRDTVRAALESLGIEAGGDFLSALGDRVFKLKNEVKQEMGFD
FRKLRFPRRCLETPSFQGRLDEAVLKDLLERYIRKAGV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggagaacgggtcttgactatcctgcacctcgatctggaccgtctgacctggaag
acggagacgcgcgccgacctggcgggctacctgggggggatcggcctggcgagcaagctt
tttgccgaattatggcggccggggctcaagcccttggacccggcccagcccgtggtgctg
gccatcgggccgctttccaccgtgtttcccctggcgaccaagacggcggccgtgtttcac
tcgccgttgacgggggagtggggcgagagctacgccgggatgcggctggccttggcgctc
cggttcgcgggctacgacgccctggtcgtcaccgggcgggccgcgcacccggtctacgcc
tcggttacgccgggccgggtgtccttccgggacgcgcggggcctctggggcctttccacc
gaggagaccgggcgcattctgcgggagtgggaggcggggcgggggcaccgcagcacggtc
cgaatcgggccggccggggagcggggcgtagccttcgccggggtgaacgtggacaccttc
cgccatttcggacgcctgggcctgggtgccgtgttcggcgccaagaaactcaaggcgctg
gtggtttacggagacaagagttttccgatcccggaccgcaaagcctaccgggcggtgtac
gacgaggtgttccggcgggcggtggagaccgacctgttggagaagtaccacgggctgggc
acggcgggaaacgtcatggtgctcgacgggctgggcgccctgcccaccaggaacctgcgg
cagaaccggttcgagcacgccgcgcggatcagtggcgaggcgttcgctgagcaaactttg
ctccgcaagctggcctgtcccggctgcccggtgggctgcatccacatcgggctgtaccgg
cggcagttcggcaccggttacgaatacgagagcatcgcgctggcctacgaccacgaattg
atctacgccctggggtcgctgctgggcatcggcgataccgacggtgtgtacgccctgatc
gagaaggtagagcttttaggcctggacgccatcaccagcggggtgctgctggcctgggcc
accgaagctctccaagaaggactgatcagcgcggaggaactgggggtgcggctggccttc
ggaaagccggacggttacctggctgccctggaccgggtggttcgccagccgaacgacctg
taccggactttggcccgcgggctggaagccgcggcgcgcacttacgggggccgcgacttc
gcgctgaccttgggcgggcacgagatggccggctaccacaccgggtacgggttcctgctg
ggccaagccgtgggtgcgcggcactcgcacctgtgcaacgccgggtacgcggtggaccag
gacctcggtcccgatttcgaccccgacgtcttggtggaacgcctgatcgccgaggagaag
tggcgccaggtgttaaacagcctttgcatctgtctgttcggtcgcggggtgtgggaccgg
gatacggtgcgggcggcgttggaaagcctggggatcgaggccgggggggatttcctttca
gccctcggtgatcgggtcttcaagcttaagaacgaagtcaagcaggaaatgggctttgac
ttccgcaagctgcggttcccgcgccgctgcctggagaccccctctttccaggggcgcctg
gacgaggcggtgctcaaagacctcctggaacggtacatcaggaaagccggcgtataa

DBGET integrated database retrieval system