KEGG   Candidatus Desulforudis audaxviator: Daud_0199Help
Entry
Daud_0199         CDS       T00655                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dau  Candidatus Desulforudis audaxviator
Brite
Enzymes [BR:dau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Daud_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
227092..230157
Genome map
AA seq 1021 aa AA seqDB search
MDNQFFEKPILNSPYEYPARHWELDDQGQPTQRIIDRRRRAEFITPIPKPRKRKDSLDQQ
QMVFDEGKGLSTKAQQYDPTSIINEIRRHVDQWRSSSPGDWRVTPETARLLHHWRHHKFS
NIQPFFCQVEAVETVIWLTEVAPKIGKIGQPFLEHLINANNEANPGLLRLALKLATGAGK
TTVMAMLIAWQTINAVRQPNSKRFTRGFLVVCPGLTIRDRLRVLQPNDPDSYYQSRELVP
NDMLRDLERAKIVITNYHAFKLRERMELSKGGRSLLQGRGAALNTLETEGQMLQRVMPEL
MGMKNILVLNDEAHHCYREKPKSDAEGELKGDDRREAEKNNEAARVWISGLETVNRKLGI
TRVIDLSATPFFLRGSGYAEGTLFPWTVSDFSLMDAIECGIVKLPRVPVADNIPGGEMPK
FRNLWEHIRTRMPKKGRGKAKSLDPLSLPVELQTALDALYGHYEKTYELWQKSGIRVPPC
FIVVCNNTSTSKLVYDYISGFYRENEDGSTTLENGRLALFRNFDEHGNPLPRPRTLLIDS
EQLESGEALDDNFRAMAADAIERFRREIIERTGDRRQAENLTDQELLREVMNTVGKEGRL
GESIRCVVSVSMLTEGWDANTVTHVLGVRAFGTQLLCEQVIGRALRRQSYDLNEDGLFNV
EYADILGIPFDFTAKPVIAPPQPPRETIQVKAVRPDRDHLEIRFPRVEGYRVELPEERLT
AKFNDDSILELTPDIVGPSITKNAGIIGEDVDLSLQHLEDIRRSTLLFHLTKRLLYTKWR
DHGEEPRLHLFGQLKRITRQWLDNYLVCKGGTFPAQLMYQELADMACERITAGITRSLVG
ERPIKAILDPYNPTGSTIHVNFNTSKKNRWETDPRRCHINWVILDSDWEAEFCRVAESHP
RVKAYVKNHNLGLEVPYRYGSEVRKYIPDFIVLVDGGHGEDNLLHLVVEIKGYRREDAKE
KKTAMETYWIPGVNKLKQYGRWAFAEFTEVYRIEADFEARVEAEFNKMIDSVTTRPTVEG
S
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggataatcaattctttgaaaagccaatccttaactctccctatgagtatccggcgcgg
cactgggaacttgatgatcagggccagcctacgcaacgaatcatcgacaggcgccgtcgc
gccgagttcatcacgccgattccgaagcccaggaaacgcaaggattcactggaccagcaa
cagatggttttcgatgaaggcaaagggctttcgacgaaagctcagcagtatgatcctacg
tccattatcaatgagattcgacgccatgtagaccagtggcgcagcagttcccccggtgat
tggcgcgtcacgcccgaaaccgcccggctgcttcaccactggcgacatcataagttcagc
aacatccagccgtttttctgccaggtcgaagcggttgagacggtcatctggttgacggaa
gtggctccgaaaatcggcaagatcggccagccattccttgaacaccttatcaatgctaac
aatgaggccaacccgggcctgctgcgtctggccctgaagctggctaccggtgccggcaaa
accacagtaatggccatgctgattgcctggcagaccatcaatgccgtgcgccagcccaat
agcaaacgattcacccgggggttcttggttgtctgcccgggtctgactatccgcgaccgg
ctccgcgtgcttcagcccaatgatccggacagctactaccagagccgggaactcgtcccc
aacgatatgctccgcgatctggaacgggctaagatcgtcatcaccaactaccacgccttc
aaactccgcgaacgcatggagctgtccaagggcggccggtcgctgcttcagggccggggc
gcggcgctcaacacgttggaaaccgagggacagatgctccagcgggtgatgcccgagctg
atgggtatgaagaacatcctggtgctcaacgacgaggcgcatcattgttaccgtgaaaag
cccaaaagcgatgccgagggcgagctgaaaggcgatgaccggagggaagccgagaaaaac
aacgaagctgcccgtgtttggatctccggcctcgaaaccgtcaaccgcaaactcggtatc
acgcgcgtcattgacctatcggcaacgccgttcttcctccggggctccggctacgctgag
ggtacgctgttcccctggacggtgagtgacttctcgctgatggacgccatcgaatgcggc
atcgtcaaactgccgcgcgttcctgtggccgataacatccctggcggggagatgcccaag
ttccgcaacctctgggagcacattcgcacgcggatgcctaagaaaggccggggtaaggca
aagagccttgatccgctgagcctgccggtcgagctgcaaactgcgctcgatgccctttat
gggcattacgaaaagacatatgaactatggcagaaaagcggtattagagtcccgccctgc
ttcattgtggtctgcaacaatacgtccacctccaaactggtgtacgactatatttccggc
ttctaccgggagaacgaagacggttcgaccacccttgagaacggacgcctggcactcttt
cggaacttcgacgagcacggcaacccactcccccgtccacggacgctgttgatagacagt
gagcagctcgaatccggcgaagcactggacgataacttccgcgctatggctgccgatgcg
atcgagcgtttccgacgcgagatcatagaacgtaccggcgaccgccgccaggccgagaac
ctgacagatcaggagttgctgcgggaagtcatgaataccgttggtaaggaaggtcgcctc
ggcgagtcgattcgctgcgtggtatcggtttccatgcttactgagggctgggatgctaac
accgttacgcatgtgctgggcgtgcgtgcctttggcactcagctcttgtgcgagcaggtc
atcggccgtgcgttgcgccgccagtcctatgacctcaatgaggacggcttgtttaacgta
gaatatgctgacatactggggataccgttcgacttcaccgccaagccggttattgcgccc
ccgcaaccgccccgtgagaccatccaggtcaaggctgtgcgacccgaccgcgaccacctc
gagatccgttttccgcgcgtcgaaggttaccgtgtcgaactgcccgaggaaaggcttacc
gccaaattcaacgacgactccattcttgagctgaccccagatatcgtcggcccctcgatc
accaagaacgcggggattattggtgaagacgtcgacctcagcctgcagcatctggaagat
atacggcggtccacgctgctgtttcaccttaccaaacgtttgctgtacaccaagtggcgg
gaccacggggaagagcccagactccacctgttcgggcagcttaagcgaatcaccaggcag
tggctcgataactatttggtctgcaagggcggcaccttccccgcgcaactaatgtatcag
gagttggcggacatggcttgtgagcgcataaccgccggcatcacccgttcgttggtgggt
gaacggcccattaaggctatactggacccctataaccccactggctccactatccacgtg
aacttcaatacctcgaagaaaaaccgctgggagaccgacccacgccgctgtcacatcaat
tgggtcatcctcgacagcgactgggaggccgagttctgccgcgttgctgagtcccatcca
cgggtcaaggcttatgtcaagaaccacaacctcggactggaagtaccgtaccgctacggt
tcggaggtacggaagtacatccccgacttcatcgtcctagtcgacggcgggcacggcgag
gacaacctgctccacctggtcgtcgagatcaaggggtaccggcgcgaggacgccaaggag
aagaagaccgccatggagacctactggatacccggggtcaataagctcaaacagtatggc
cgctgggcgtttgccgagttcaccgaggtctaccgcatcgaggccgactttgaggccagg
gtcgaagccgagttcaacaagatgatcgattcagtcaccactcggccgacggtggagggg
agttaa

DBGET integrated database retrieval system