KEGG   Candidatus Desulforudis audaxviator: Daud_0281Help
Entry
Daud_0281         CDS       T00655                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daud_0281
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daud_0281
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Daud_0281
Enzymes [BR:dau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Daud_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(302306..303802)
Genome map
AA seq 498 aa AA seqDB search
MLYESTRGRTRPVTVSEALKLGIAPDGGLFVPECLPVLSPDQLTGAAAADYQQRAARILE
LFLTDFSPGEISESVTRAYNAGKFDNPDVAPVRTVAPNLHFLELWHGPTYAFKDMALQIL
PYLLMKAVASTGETAEIVILVATSGDTGKAALEGFRDVTGTRIIVFFPAAGVSEIQRLQM
VTQEGGNVHVVAVRGNFDDTQSGVKALFTDPSVNDALQQRGHRFSSANSINWGRLVPQIV
YYFSAYLDLQDREAISPGQAVNFVVPTGNFGNILASFYARCMGLPVNRLICAANRNNVLT
DFIRTGTYDRNRTFYRTISPSMDILISSNLERLLYELTGRNAPQVDRWMAELRETGRYQV
DPRTREQVAHHFWSDFADEDETEAEIASTWQEHHYLIDTHTAVGKAVLNKYRAATGDHTP
AIVVSTASPFKFNQAVARSLLGRDAVAGRNEFELLEALAAFTGLEIPSGLRDLDKKPVLH
TRVVGKEEMKQVVLDILG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatgagagcaccaggggccgcacccggcccgtgacggtctccgaggccctaaag
ctgggcatcgcgcccgacggggggcttttcgtccctgagtgcctgccggtgctgtccccc
gatcagttaaccggagcggccgcggcggactaccagcagcgggcggcccgcatcctggaa
ctgttcctgaccgacttcagcccgggcgagattagtgagagcgtgacacgggcctacaac
gcggggaagttcgacaaccccgatgttgctccggtccgcaccgtggccccgaacctgcac
ttcctggaactctggcacggacccacgtacgccttcaaggacatggctctgcaaatcctc
ccttacctgctcatgaaggcggtagccagcacgggcgaaaccgccgaaatcgtcattctg
gtcgccacctctggggacaccggcaaggctgccctggaggggttccgggacgtgaccggg
acgcggatcatcgtcttcttcccggccgcgggcgtgagtgagatacaacgcctgcaaatg
gtaacccaggaggggggcaacgtacacgtggtggccgtgcggggcaacttcgacgacacc
cagagcggcgtgaaggccctgttcaccgacccgtcggtcaacgatgccctgcagcagcgc
ggccaccggttttcttcggccaactcaatcaactggggtcggctggttccccagatcgta
tactacttttcggcctacctcgacctgcaagaccgggaggccatcagccccgggcaagcc
gtgaacttcgtggtgcccaccggcaatttcggcaacatcctggccagcttttacgcccgg
tgcatgggattgccggtcaaccggctgatctgcgcggcgaaccggaacaacgtgctcacc
gactttatccgcaccggcacctacgaccggaaccgaaccttttaccggactatttcgccg
tccatggacatcctgatctccagcaacctggaacggctgctttacgaattgaccggcaga
aacgccccgcaggtcgatcgctggatggctgagctgcgggagacgggacgctaccaggtt
gatccacgcacccgggagcaggtcgctcaccatttctggtcggatttcgcggacgaggac
gaaaccgaggccgaaatagcgtccacctggcaggaacaccactacctaatcgacacccac
acagcggtgggcaaagccgttctgaacaagtaccgagctgccacgggcgaccataccccg
gcgatcgtggtgtccaccgcgagtcccttcaagttcaaccaggcggtggcccgctccctg
ctggggcgggacgcggtcgcgggtaggaacgagttcgagctcttggaggcgctggccgcc
ttcaccggcctcgagatcccctcagggctgcgcgacctggacaaaaagcccgttctgcac
acgcgggtggtcgggaaagaggaaatgaaacaggtcgtcttggacatcctggggtag

DBGET integrated database retrieval system