KEGG   Candidatus Desulforudis audaxviator: Daud_0304Help
Entry
Daud_0304         CDS       T00655                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daud_0304
   01230 Biosynthesis of amino acids
    Daud_0304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_0304
   00051 Fructose and mannose metabolism
    Daud_0304
   00562 Inositol phosphate metabolism
    Daud_0304
Enzymes [BR:dau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Daud_0304
Exosome [BR:dau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Daud_0304
  Exosomal proteins of bladder cancer cells
   Daud_0304
  Exosomal proteins of melanoma cells
   Daud_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
331224..331997
Genome map
AA seq 257 aa AA seqDB search
MVRQPIIAGNWKMYKTPSEAVEFVRRLQEASAGVDNVEIVVAPPFPALVPVAGVLAGSFI
GLAAQNMFWEAEGAFTGEVSPVMLAEIGCRYVILGHSERRQYFGETDANVNRKAWAALDR
GLVPIVCVGESLDEREAGRTEKVVTAQIQGCLAGLPADAVAGLVIAYEPVWAIGTGRTAS
PADAQEVSARIRALVAELFGREAADRVRIQYGGSVKPENTRALISQPDIDGALVGGASLK
VESFAGIIRETGGAVGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggtgcgccagccgattatcgccggcaactggaagatgtacaagacgccttccgaagcc
gtggaattcgtgaggcggctccaggaggcgagtgccggcgttgataacgtggaaatcgtg
gttgcaccgccgtttccggctttggtaccggtggccggggtgttggccgggtcgttcatc
ggcctggccgcccagaacatgttctgggaagccgaaggggctttcaccggcgaggtttcg
ccggtgatgctggcggagatcggctgccggtacgtgatcctcggccactccgaacggcgg
cagtacttcggggaaaccgacgcgaacgtgaaccgcaaggcttgggccgcgctggaccgg
gggctggtcccgatcgtctgcgtgggggagtccctggacgagcgcgaggcgggccggacc
gagaaggtggtcaccgcccagatccaggggtgcctggccggattgccggcggacgcggtg
gccgggctggtcatcgcctacgaaccggtttgggcgatcgggacgggccggaccgctagt
cccgcggacgcccaggaggtaagcgcccggatccgcgccctggtggccgaactcttcggc
cgggaggcggcggaccgggtccggatccagtacgggggcagcgttaaaccggagaacacc
cgtgcgctgatatcccagccggacatcgacggggccctggtgggaggggcgagcctgaag
gtcgagagtttcgccggcatcatccgggagaccgggggggcggtggggcgttga

DBGET integrated database retrieval system