KEGG   Candidatus Desulforudis audaxviator: Daud_0818Help
Entry
Daud_0818         CDS       T00655                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daud_0818
Enzymes [BR:dau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Daud_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
863295..865361
Genome map
AA seq 688 aa AA seqDB search
MTETITDTVNRFIFKTETFAIFKLDNIVALGDVAGVREGDRLTVTGSWQEHPKYGRQLRV
EHWEKPVPSTEEAAADFLSSGLIKGVGPVLAERIVSVLGPNAVSAILEDPDVLKKVKGIG
KKAPEIRRQLQETYQVQQVVAELIRLGLTLKTAMKAYMKFGRPAAEYVRRNPYCLTELDL
IGFHRADDIARRAGLAPDSSFRVKAGILYVLNESLWDEGHAYLPRDELISRSLTLLNHVE
KSVSLDIVEKELSRLKGVHGSAEVSLAWAREYEEEIARDVKRLARQRFDVPPLPRDLIRG
IELTPDQNAAVKTALESGFSILTGGPGVGKTQTVRAVIRAFELQNPWGGVFLCAPTGRAA
RRLSEVTGRQAHTVHKLLGLRNGHADRNRKNPLECDLLILDEASMACLVLTKRLLEAVPN
NARILFVGDADQLPSVGPGNILRDLLDKVPTVRLTEIFRQAAESQIVTNAHRINRGQMPL
IDRSKTDFIFLEREDPEDIAKCVATCASGMGYDPLDVQVLSPMRKGPVGTAELNKLIQGG
MSGPRVKYGQYVFHVGDKVIHTKNNYDKGVFNGDIGIIKKIKMQHDVLVQYSSGLVSYSG
DDLRELEPAWAVTVHKAQGSEFKAVIIPVTTSHYVMLHRNLIYTAVTRAREKVILVGTKK
ALAIAVRNNKPIQRYTALSGLLRDAPRR
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaccatcaccgacaccgtaaaccggttcattttcaaaactgaaaccttcgcc
attttcaagcttgataacattgttgcgctgggcgatgtcgctggcgttcgcgagggcgac
cgcttgaccgttactggctcctggcaggagcatcctaaatacggcaggcagctcagagtc
gaacactgggagaaacccgtcccgtccaccgaagaagccgctgcagactttctttcttcc
ggcctgatcaagggcgtgggcccggtattggcagagcgaattgtgagcgttcttggtccc
aatgccgtgagtgcgattttggaagatccggacgtattgaagaaggtcaagggcatcggc
aaaaaagccccggaaattcgccgtcagcttcaggagacctatcaagtgcagcaggtcgta
gcagagctgatacggcttgggctcactttgaaaacggcgatgaaggcttacatgaaattc
ggccgcccggccgccgagtacgttcggagaaacccctactgcctgaccgaactggatctg
atcgggttccaccgggcggacgacattgcccggcgggccggcctggctccggattcttct
tttagagtcaaggccggaatactgtatgttttaaacgaatctctctgggacgagggtcat
gcctacctgcccagggatgagctcatttcccgctccctgaccttgttgaaccatgtcgaa
aaaagcgtgtcgctggacattgtggagaaagaactctcccgccttaaaggggttcacgga
agtgcggaagtctctctggcctgggccagggagtacgaagaagagatcgcccgggacgtg
aaaaggttggcccggcaacggttcgatgtaccgcctttgccccgggatctgatcaggggc
attgagctgacccctgaccagaatgcagcagttaagactgcgctggagagcggcttttct
atcttgaccggcggtcccggcgtgggcaagactcagactgtaagggcggtcatcagggcc
ttcgagttgcagaacccttgggggggagtatttctttgcgctcctacagggagagcagcc
agaaggctttcggaggtgaccgggcgccaggcgcacaccgtgcacaagcttctgggcctc
cggaacggccacgcagaccgcaaccgcaaaaacccgctggaatgcgatctgttgattttg
gacgaagcgagcatggcctgcttggttttgaccaagcgcctcctcgaagccgttcccaac
aacgccaggatccttttcgtcggagacgcggaccagcttccgagcgttggcccgggcaac
attttgcgcgatctgctggacaaagttccgactgtccgcctgaccgaaatctttcgccag
gctgccgagagccagatcgtaacgaacgctcaccggataaataggggccagatgccgctg
attgaccgctcgaagacggactttatattcctggaaagagaagatccggaagacatcgca
aagtgcgtggcgacttgcgcttccgggatgggttacgatcctttggacgtgcaggttctt
tcgccgatgcgaaagggcccggtggggacggctgagctcaataagctcatccaggggggg
atgtccggccccagggtgaaatacggccagtacgtcttccatgtgggcgacaaggtgatc
cacacgaagaacaactatgacaaaggggttttcaacggcgacatcgggattatcaagaag
atcaagatgcagcacgatgtcctggtgcagtacagcagcggcctggtttcctattccggg
gatgacctgagagagcttgagccggcgtgggcggtcacggttcacaaggctcagggctct
gagtttaaggctgtaataattcccgtcaccacctctcactatgtcatgctgcaccgcaac
ctgatctataccgccgtcaccagggccagggaaaaagtgattctggtgggcacgaagaag
gctttggccattgcggtgcgcaacaacaagccgattcagcgttacaccgcgctttcgggc
ctcctgagagacgcgccccgccgttaa

DBGET integrated database retrieval system