KEGG   Candidatus Desulforudis audaxviator: Daud_0866Help
Entry
Daud_0866         CDS       T00655                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dau00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
922442..924505
Genome map
AA seq 687 aa AA seqDB search
MTADGENRHHEVRLLRRLAALHGVQTGYHGVTGRYEEARPEALLAVLAALGAPVNGFPDL
RDAMRERRQAVWRRCCEPVVVGWTGEHIQMHLRLPVRGSAGPFHWRLELEGGEVRHWSGD
LDRLRILKNAAVAGVDYVIRQFVLPPGLPWGYHRLTLVLPTGVWETLVIVAPREAYLPPD
GVTGRTWGVFLPLYALHSERTWGAGDLGALEDLLGWVRASGGSLVGTLPLLPAFLDEPFD
PSPYAPVSRLFWNEFYLDVGRIPELESCPAARELIESPVFREEIEDLRAAPLVDYRRGMA
ARRRVFELLARCCFSGGSDRQVALWRWVKAHPAVRDYARFRAVAERQRAGWPAWPERMRD
SALREGDYDPEAERYHLYVQWLAHEQFEALSARTRKPGSGLYLDLPLGVHGGGYDTWRER
DAFALDASGGAPPDAFFTEGQEWGFPPLHPERIREQGYHYYIASLRHHLRHAGVLRIDHV
MGLHRLFWVPRGLGAQNGVYVRYRAREFYAVLALESHRYRTLIVGEDLGVVPGYVRKAMA
RHRVQRMYVLPFEHTPESRRRFNAVPADSLAALNTHDMPPFAGDWFQKENVEQVALCLSL
HHQGWLVVPPDEPGAVLQACLANLAASRARILLVNLEDLWLEKRPQNVPGTGVERGNWRR
KARYSFEEFSREPGILEILGEINALRK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
ttgacggctgacggagaaaaccgtcaccacgaagtccgcctgctccgccggttggcggcg
ctgcacggcgttcagaccgggtaccacggtgttacgggccggtatgaagaggcgcggccg
gaagcactgttggcggtgctcgcggcgctgggggcgccggtaaacgggttccccgacttg
cgcgatgccatgcgggaacgccggcaggccgtttggcggcgctgctgcgaaccggtggta
gtcgggtggaccggggaacacattcagatgcatctacgcttgcccgtccgggggtcggcg
gggccgttccactggcgtctggaactggagggcggggaggtgcggcactggtccggcgac
ctggaccgtctgcggatattgaagaacgcggcggtggctggtgttgactacgtgatcagg
cagtttgtcctgcccccggggctgccatggggctaccaccggttgacgctggtccttccg
actggggtttgggaaaccttggtcatcgtcgccccgcgcgaagcttatcttccgccggac
ggggtgacgggccggacctggggggtttttctcccgctgtacgcgctccattcggagcgg
acgtggggcgccggcgacctgggggccctggaggatcttctgggctgggtgcgggcgtcg
ggaggtagcctggttggtactttgccgctcctgcccgcttttctggatgaacccttcgac
ccgagtccgtatgcccccgtgagccgccttttttggaacgagttctacctggacgtcggc
cggattccggaattggaaagctgcccggctgcccgggagctgatcgagtctccggtcttc
cgggaggagatcgaagacctgcgggccgcaccgctggtggattaccgccgcgggatggcg
gcgaggcgccgggtgttcgaactcctggcgcgctgctgcttcagcggggggtcagaccgg
caggttgccctgtggcgctgggtgaaggcgcaccccgcagtaagggattacgcccggttc
cgggccgtggcggagcggcagcgcgccggctggccggcctggcccgaacggatgcgggac
agcgccctccgggagggggactacgacccggaggcggagcgctaccacctgtacgtgcag
tggctggcgcacgagcagttcgaggccctttcggcgcggacccgaaagccggggtccggg
ttgtacctggatttgccgttgggggtacacggcggcgggtatgacacctggcgggagcgg
gacgctttcgccctggacgcgagcggcggggcaccacccgacgcgttcttcaccgagggt
caggaatggggttttccgcccctgcatcccgagcggatccgggagcagggttaccattac
tacatcgcgagcctgcgccaccacctgaggcacgccggcgtcttgcggatcgaccacgtg
atggggctgcaccggctcttctgggtgccccggggcctgggtgcccaaaacggggtctac
gtgcgctaccgcgcccgggagttctacgccgtcctggccttggaatcacaccggtaccgg
acgctgatcgtcggcgaggatctgggggtggtgcccggctatgtgcgtaaagcgatggcc
cgacaccgggtgcagcggatgtacgtgctgcctttcgaacacaccccggagtcccgccgc
cggtttaacgccgtgccggcggactccctggccgctttgaacacgcacgacatgccgcct
ttcgccggtgactggttccagaaggagaacgtggagcaggtggccctgtgcctttccctg
caccaccagggctggctcgtggtccccccggacgaaccgggggcggtgctgcaggcctgt
ctggccaacctggcggcaagccgggcccggattctcctggttaacctggaggacctctgg
ctggagaagaggccccagaatgtgcccggcacgggcgtggaacgcggcaactggcggcgc
aaggcgcggtactcgtttgaggagttcagccgggaacccgggatcctggagatactcggg
gagatcaatgcgctgcggaagtag

DBGET integrated database retrieval system