KEGG   Candidatus Desulforudis audaxviator: Daud_1055Help
Entry
Daud_1055         CDS       T00655                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00010  Glycolysis / Gluconeogenesis
dau00030  Pentose phosphate pathway
dau00051  Fructose and mannose metabolism
dau00052  Galactose metabolism
dau00680  Methane metabolism
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01120  Microbial metabolism in diverse environments
dau01130  Biosynthesis of antibiotics
dau01200  Carbon metabolism
dau01230  Biosynthesis of amino acids
dau03018  RNA degradation
Module
dau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1055
   00030 Pentose phosphate pathway
    Daud_1055
   00051 Fructose and mannose metabolism
    Daud_1055
   00052 Galactose metabolism
    Daud_1055
  Energy metabolism
   00680 Methane metabolism
    Daud_1055
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Daud_1055
Enzymes [BR:dau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Daud_1055
Protein phosphatases and associated proteins [BR:dau01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Daud_1055
Messenger RNA biogenesis [BR:dau03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Daud_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase TRADD_N
Motif
Other DBs
NCBI-ProteinID: ACA59567
UniProt: B1I3G9
Position
1110208..1111170
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDAPGMNAAIRAVVRKAIYHGLEVMGVSRGFAGFIDADIGPMQVGSVADI
IHRGGTILRTARSDEFQTRSGRARAYQNVERFRIQGLVIIGGDGSFMGAKLFHEEFQVPV
VCIPATIDNDIPGTELSIGFDTAVNNAVDAINKIRDTATSHERLFIVEVMGRRAGFIALE
AGLAGGAESILIPELPFSVEEVCDKLMRGYRRGKLHSVIVVAEGAASGIEFGREIKRITG
FDTKVTVLGHLQRGGTPTAQDRVLGSRLGALAVELLMEGRCKLAVGIRNGRPDHWDLDEC
LDGKKEIDLEAYRLAGILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcggataggggttttgaccagcggtggggacgcccccgggatgaacgccgcgatc
cgggccgtggtgcgcaaggccatctaccacggtctcgaagtgatgggtgtcagccgcggt
tttgccgggttcatcgacgcggacatcggacccatgcaggtcggttcggtggccgatatc
atccaccggggcgggaccatcctgcgcaccgcccgatcggacgagttccagacgcggtcg
ggccgggcgcgcgcttatcagaacgtggagcgttttcgtattcaggggctggtgatcatc
ggcggggacggttcttttatgggggcgaagctttttcatgaggagttccaggtgccggta
gtttgcattccggccacgattgacaacgacatacctggcaccgagctttctatcgggttt
gacaccgcggtcaacaatgcggtggatgccatcaacaagatccgggatacggccacgtcc
cacgagcgactgttcattgtggaagtgatggggcgcagggccggtttcattgccctggaa
gccggtcttgccgggggggcggagtccattctgatcccggagctgccgttttccgtggaa
gaggtttgcgacaagttgatgcgcggctaccggcgcggtaaactccacagcgtaatcgtc
gttgccgaaggggcggcaagcggtatcgagttcgggcgggaaataaaacggattaccggt
tttgataccaaagtgaccgtactgggccaccttcagcgcgggggtacgccgaccgcccag
gaccgggttttggggagccgcctgggggctctggccgtggaacttctgatggaagggcgg
tgcaagctcgcggtcggaatccggaacggccggccggaccactgggaccttgatgaatgc
ctggatggaaagaaagagattgacctggaagcttaccgtcttgccggaatcctgtcaatt
tga

DBGET integrated database retrieval system