KEGG   Candidatus Desulforudis audaxviator: Daud_1055Help
Entry
Daud_1055         CDS       T00655                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daud_1055
   01230 Biosynthesis of amino acids
    Daud_1055
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1055
   00030 Pentose phosphate pathway
    Daud_1055
   00051 Fructose and mannose metabolism
    Daud_1055
   00052 Galactose metabolism
    Daud_1055
  Energy metabolism
   00680 Methane metabolism
    Daud_1055
Enzymes [BR:dau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Daud_1055
Protein phosphatases and associated proteins [BR:dau01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Daud_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1110208..1111170
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDAPGMNAAIRAVVRKAIYHGLEVMGVSRGFAGFIDADIGPMQVGSVADI
IHRGGTILRTARSDEFQTRSGRARAYQNVERFRIQGLVIIGGDGSFMGAKLFHEEFQVPV
VCIPATIDNDIPGTELSIGFDTAVNNAVDAINKIRDTATSHERLFIVEVMGRRAGFIALE
AGLAGGAESILIPELPFSVEEVCDKLMRGYRRGKLHSVIVVAEGAASGIEFGREIKRITG
FDTKVTVLGHLQRGGTPTAQDRVLGSRLGALAVELLMEGRCKLAVGIRNGRPDHWDLDEC
LDGKKEIDLEAYRLAGILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcggataggggttttgaccagcggtggggacgcccccgggatgaacgccgcgatc
cgggccgtggtgcgcaaggccatctaccacggtctcgaagtgatgggtgtcagccgcggt
tttgccgggttcatcgacgcggacatcggacccatgcaggtcggttcggtggccgatatc
atccaccggggcgggaccatcctgcgcaccgcccgatcggacgagttccagacgcggtcg
ggccgggcgcgcgcttatcagaacgtggagcgttttcgtattcaggggctggtgatcatc
ggcggggacggttcttttatgggggcgaagctttttcatgaggagttccaggtgccggta
gtttgcattccggccacgattgacaacgacatacctggcaccgagctttctatcgggttt
gacaccgcggtcaacaatgcggtggatgccatcaacaagatccgggatacggccacgtcc
cacgagcgactgttcattgtggaagtgatggggcgcagggccggtttcattgccctggaa
gccggtcttgccgggggggcggagtccattctgatcccggagctgccgttttccgtggaa
gaggtttgcgacaagttgatgcgcggctaccggcgcggtaaactccacagcgtaatcgtc
gttgccgaaggggcggcaagcggtatcgagttcgggcgggaaataaaacggattaccggt
tttgataccaaagtgaccgtactgggccaccttcagcgcgggggtacgccgaccgcccag
gaccgggttttggggagccgcctgggggctctggccgtggaacttctgatggaagggcgg
tgcaagctcgcggtcggaatccggaacggccggccggaccactgggaccttgatgaatgc
ctggatggaaagaaagagattgacctggaagcttaccgtcttgccggaatcctgtcaatt
tga

DBGET integrated database retrieval system