KEGG   Candidatus Desulforudis audaxviator: Daud_1116Help
Entry
Daud_1116         CDS       T00655                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00010  Glycolysis / Gluconeogenesis
dau00030  Pentose phosphate pathway
dau00051  Fructose and mannose metabolism
dau00052  Galactose metabolism
dau00680  Methane metabolism
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01120  Microbial metabolism in diverse environments
dau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1116
   00030 Pentose phosphate pathway
    Daud_1116
   00051 Fructose and mannose metabolism
    Daud_1116
   00052 Galactose metabolism
    Daud_1116
  Energy metabolism
   00680 Methane metabolism
    Daud_1116
Enzymes [BR:dau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Daud_1116
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Daud_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACA59627
UniProt: B1I3S0
Position
1174841..1175953
Genome map
AA seq 370 aa AA seqDB search
MSARRRKGIKKIGILTGGGDAPGINAVIRAAVKVAVNHYGIRVIGIEQGFGGLIEDRTRK
LTTKEVMGILPRGGTILGTTNRDNPFHYPIRLESGEVEFRDVSIRVPETLAKHAIEALIV
IGGDGSLKIASQLWEKYAVPVVGVPKTIDNDLSATDQTFGFDTALKTATEAIDKLHTTAE
SHYRIMVLEVMGRYAGWIALQAGLAGGADVILIPEIPFDIYKVCDKIKERSAAGKQFSIV
VVAEGARAIGGEMVVKKVVEDSFEKIRLGGIGNVVGEQIEEITGIETRVTVLGHLQRGGS
PTPFDRILGSRFGAAAVNLVMEGRFGEMVCLRTPHIASVPLVEAVGEMRRVPLGSDMVRM
ARQIGVSFGN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgccaggcgcaggaaaggcattaaaaagatcggcatcctgaccgggggcggggac
gctccgggaatcaacgcggtgatccgggccgccgtcaaggtggccgtaaaccactacggc
atccgggtgatcggcatcgaacagggtttcggcggcctgatcgaagaccgtacccggaag
ctgaccaccaaagaagtcatgggcattctgccccgcggtgggaccatcctgggcaccacc
aaccgggacaacccctttcactacccgatccggctggagagcggggaagtggagttccgc
gacgtttcgatccgggtgccggagacgctggcgaaacatgccatcgaggcgctgatcgtg
atcggcggggacggaagcctgaaaatcgcctcccaactctgggagaaatacgccgtcccg
gtggtcggcgtgccgaagaccatcgacaacgacctgtccgcgaccgatcagaccttcggt
tttgacaccgccctcaagacggccaccgaggcgatcgacaagctgcacaccacggctgaa
tcgcactaccggatcatggtgctggaggtcatgggccgttacgccggctggatcgccctg
caggccggcctggccggcggggccgacgtcatcctgatccccgagatccccttcgacatc
tacaaggtgtgcgacaagatcaaggagcggagcgcggccggcaaacagttttccatcgtc
gtcgtggccgagggtgcccgggcgatcggcggggaaatggtggtcaagaaagtggtcgag
gacagcttcgaaaagatccggctggggggaatcggtaacgtggtcggtgaacagattgag
gagattaccgggatcgaaactcgggtgaccgtactcgggcacctgcagcggggcgggtcg
cccacgcccttcgaccggattctgggcagccgcttcggggcggcggccgtgaacctggtg
atggaaggccgcttcggggagatggtctgcctgcgcaccccgcatatcgcctctgtgccg
cttgtagaggcggtgggcgagatgcggcgcgtgccgttgggcagcgacatggtgcgcatg
gcgcgccagatcggggtgtctttcggaaactaa

DBGET integrated database retrieval system