KEGG   Candidatus Desulforudis audaxviator: Daud_1185Help
Entry
Daud_1185         CDS       T00655                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00260  Glycine, serine and threonine metabolism
dau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01130  Biosynthesis of antibiotics
dau01230  Biosynthesis of amino acids
Module
dau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daud_1185
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daud_1185
Enzymes [BR:dau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daud_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACA59696
UniProt: B1I3Z4
Position
complement(1240693..1241496)
Genome map
AA seq 267 aa AA seqDB search
MSGGRIAAAFGRLRERGEKGLIPFVTAGYPNLEATRSLVLAMAESGADLIELGVPFSDPL
ADGPVIQRASQAALGAGTSLAGILALVRELRRETDVPLVLMSYFNPIFSFGPGPLMSAAA
LAGADGLIIPDLPLEEAGPVLERADECGLDLIPLVAPTSTPRRIAAIAGQARGFVYCVSV
TGVTGTQAGYSEKLVGVCRTVREHTGLPIAVGFGIARDAQVRALAPHVDALIVGSAIVDL
IDGADENGSVKRVCSLVLELKQALQKI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggacggatcgccgccgctttcgggcggctgcgcgagcgcggggaaaagggc
ctgatcccgtttgtaaccgccggttacccaaacctggaggcgacgaggagcctggtgctg
gcgatggcggagtctggggccgacctgattgaactcggcgtgccgttctccgatccgctg
gccgatggtccggtgatccaacgggcctcgcaggccgcgctgggcgcgggaacaagcctg
gccgggatcctggcgctggtgcgggaactgcggcgggaaaccgacgttcccctggtgctg
atgagttacttcaaccccatcttcagtttcggcccggggccgctgatgtctgcggccgcg
ctggccggcgccgacggcctgatcattccggacctgccgctggaggaggccggcccggta
ctcgaaagggcggatgagtgcggcctggatctcatccccttggtcgcgcccacttctacg
ccgcgccggatcgcggcgatcgcggggcaggcccggggcttcgtgtactgtgtttcggtg
acgggcgttaccggcacgcaggccggttattccgaaaagctggtgggggtgtgccggacc
gtgcgcgagcataccggcctgccgatcgcggtcggttttggtatcgcccgggatgcccag
gtacgcgcgctggccccgcacgtcgacgccctgattgtaggcagtgccattgttgacctg
atcgacggcgccgatgaaaacggaagcgtgaaaagagtgtgcagcctggtacttgagctg
aaacaggctctgcagaaaatatag

DBGET integrated database retrieval system