KEGG   Candidatus Desulforudis audaxviator: Daud_1188Help
Entry
Daud_1188         CDS       T00655                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01130  Biosynthesis of antibiotics
dau01230  Biosynthesis of amino acids
Module
dau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daud_1188
Enzymes [BR:dau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Daud_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh His_biosynth UPF0184
Motif
Other DBs
NCBI-ProteinID: ACA59699
UniProt: B1I3Z7
Position
complement(1243294..1244121)
Genome map
AA seq 275 aa AA seqDB search
MLNTIIASKRSEVEALRRKMSLKALREAAAAAPRTRSLSRALREQPGVSLIAEVKGRSPS
AGVIRAAFDPVEIACIYEGAGAAAVSVLTDHTYFGGRPEYLSEIRRSVKLPLLRKDFIIS
EHQVYESRVLGADAVLLIAAVLDDHELKGLMELTAALGMESLVEVHSLAELERATAAGAS
LVGINNRDLGTFRTDLKHTRELAVHLPPEVTTVSESGIRTRDDVLALEAWGVDAVLVGET
LMRADDIDARVRELLGTSRQLRGKPLNKQYDKAGG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacacgataatcgcctctaagcgtagcgaggtggaggcgctgcggcggaaaatg
tcacttaaggccttgcgggaggcggccgccgccgctccgcgcacccggagcctgagccgg
gcgctgcgcgagcagcccggggtgtccctgatcgccgaggtaaaagggcgctccccttcg
gccggagtcatccgcgccgccttcgatccggtggaaatcgcttgtatctacgagggcgcc
ggggccgccgccgtttccgtgcttacggaccatacctatttcggcggccgtccggaatac
ctttcggagattcgccggagcgtgaaactgccgctgttgcgcaaagatttcatcatctcc
gaacaccaggtctacgagtcccgtgttctgggtgcggacgcggtgctgttgatcgccgcc
gtcctggacgatcacgaactgaagggcttgatggaactgaccgcggccctaggcatggaa
tccctcgtcgaagtccacagcctcgcggaactggaacgcgccaccgccgcgggggcaagt
ctggtggggatcaacaaccgggacctcggcactttccggaccgatcttaagcacacccgg
gaattggcggtgcatctgccccccgaagtgaccacggtgagcgagagcggcatccgcacc
cgggacgacgtgctcgcgctggaggcgtggggcgtcgacgccgtcctggtgggggagact
ctcatgcgggccgacgacatcgacgcgcgcgtccgtgaactcctggggacgagcaggcaa
ctccggggaaaaccgctgaacaaacaatacgacaaggcaggcggataa

DBGET integrated database retrieval system