KEGG   Candidatus Desulforudis audaxviator: Daud_1231Help
Entry
Daud_1231         CDS       T00655                                 

Gene name
surE
Definition
stationary phase survival protein SurE (EC:3.1.3.2)
Orthology
K03787  
5'-nucleotidase [EC:3.1.3.5]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dau00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dau00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:dau00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1293171..1293944)
Genome map
AA seq 257 aa AA seqDB search
MRILLTNDDGIFAPGLEALRNALSDLAETIYIIAPDRERSATGHSITVHRPIRVREACHA
DGNCCGWIVDGTPADCVKLALESLLPETPDLVISGINLGPNLGTDVLYSGTVSAAMEGLI
NGVPSLAISLASHREAEFEEAAAFARRLLPLVFEYREIFTANTLLNINVPPGKPVGVRLT
RLGNLRYADAVDRRVDPRGRYYYWMAGKPFSPDGHDPDTDIGAVKDRHISITPVKIDLTD
YEALDALKKWPVDWKGS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcggatactgctgaccaacgacgacggaattttcgcgcccgggctggaggcactgcgc
aacgcgctgtccgacttggccgagactatttacatcattgctccggaccgcgagcggagc
gccaccggccactccattaccgtgcaccggccaatccgggtgcgggaggcctgtcacgcg
gacgggaactgctgcggctggatcgtcgacggcaccccggccgactgcgtcaaactggcc
ctggaatcgctcctgcctgaaacccctgacctggtgatttctggcatcaacctcggaccg
aacctgggtacggacgtactctattccggcaccgtttccgccgctatggagggactgatc
aacggcgtgccgtccctggcgatttccctggccagccaccgggaagcggagtttgaagag
gccgccgccttcgcccgccgccttttgccgctggtgttcgagtaccgggagatattcacg
gcgaacaccctgctgaacattaacgtaccccccggaaagccggtcggcgtcaggctgacc
cgtctggggaatctgcgttacgccgacgccgtggaccggcgggtcgacccccggggccga
tactactactggatggccgggaaaccgttcagccccgacgggcacgatcccgacaccgac
atcggggccgtcaaggaccggcacatctctatcaccccggtgaagatcgatctcaccgac
tacgaggccctggacgccttgaaaaagtggccggttgactggaaaggcagttag

DBGET integrated database retrieval system