KEGG   Candidatus Desulforudis audaxviator: Daud_1322Help
Entry
Daud_1322         CDS       T00655                                 

Definition
(GenBank) glycogen/starch synthase, ADP-glucose type
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00500  Starch and sucrose metabolism
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Daud_1322
Enzymes [BR:dau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     Daud_1322
Glycosyltransferases [BR:dau01003]
 Polysaccharide
  Storage polysaccharide
   Daud_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ACA59832
UniProt: B1I4F5
Position
complement(1398446..1399948)
Genome map
AA seq 500 aa AA seqDB search
MFDRPLKILFVSSEVVPFAKTGGLADVAGSLPKALATVVDHGLSHHDVRVAMPRYKMIED
ARYVTDFPVWFADKNHEAIIRQREIEAQFQGARHTVPVYMIDNYQYYYRDGIYVFDDEAE
RFGFFCKAVLEMLPRLGWQPDVIHCNDWQCGPIPLFLKTHYRGDPFFSRMATVFTIHNLQ
YQGNFPKEVLHMLGLGKEYFRPEALEFYGSVSFMKAGIQYADVLTTVSRTYAREIQTPEY
GQRMEGVLRQRAHELYGIVNGINYHEFDPKTDPRLHRNYDVDHWEHKKENKFTLQREMNL
PVRDVPVLGLITRLVDQKGLDLIAEIIDELMRLDIQMVILGKGDKYYEDMFREMKVQHPG
KIAAHIGFNVVLAQRIYAGSDMFLMPSRFEPCGLGQLISLRYGTIPIVRETGGLADTVNE
YDLATGGGNGFVFKEYDARALYSAIARALKLYREDQEAWGRLVRNAMEMDFSWARSAVEY
LQVYRDAMEKVSEERGIRIA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccgtccgctgaaaatacttttcgtatcttcggaagtggttccgttcgccaag
accgggggactggccgatgtcgctggctccctgcccaaggcgctcgcgactgttgtcgac
cacgggctgtcgcatcacgacgtccgggtggcgatgccacgttacaaaatgatcgaggac
gcccggtacgtgaccgactttccggtctggttcgcggacaaaaaccacgaggcgatcatc
cgccagcgtgaaatcgaggctcagttccagggcgcgcgccacaccgtccccgtgtacatg
attgacaactaccagtactactaccgggacggaatctacgtcttcgacgacgaggccgag
cgtttcggattcttttgcaaagcggtgttggagatgctgccgaggctgggctggcagccg
gacgtgatccactgtaacgactggcagtgcggcccgatcccgctgttcttgaagacacac
tatcgcggggacccgttcttcagccgcatggccaccgtctttaccatccacaacttgcag
taccaggggaacttccccaaggaggtgctgcacatgctgggcttgggcaaggagtacttc
cggccggaagcactggagttttacggcagcgtgagcttcatgaaggccggcatccagtac
gccgacgtgcttaccaccgtaagccggacctacgcccgggagattcagacccccgaatac
gggcagcggatggagggcgtgctacggcagcgcgcgcacgaactttacggcatcgtgaac
gggatcaactaccacgagttcgacccaaaaaccgacccgcgcctgcaccggaactacgat
gtggaccactgggagcacaaaaaggaaaacaagttcaccctgcagcgggaaatgaacctg
ccggtccgggatgttccggtgctggggctgatcacgcggctggtggaccagaagggcctg
gacctgatcgcggagatcatcgacgaattgatgcgtctggatatacagatggtgattctg
ggcaagggcgacaagtactacgaggacatgttccgggagatgaaggtgcagcatcccggg
aagatcgctgcccacatcggtttcaacgttgttctggcccagcggatttacgccggctcg
gacatgttcctcatgccttcccgatttgagccctgcgggctgggacaattgatcagcctg
cgctacggaaccattcccatcgtccgggaaaccggcggcctggccgatacggtgaacgag
tacgatctggccaccggcggcggtaacggctttgtctttaaggagtacgacgcccgggcc
ctgtacagcgctatcgcccgggccctcaagctttaccgcgaggatcaggaagcctggggc
cggctggtgcggaacgccatggagatggacttctcctgggcccgttcggccgtggagtac
ctccaggtgtaccgggacgcaatggaaaaggtcagcgaggaaagaggcatccgcatcgct
tga

DBGET integrated database retrieval system