KEGG   Candidatus Desulforudis audaxviator: Daud_1572Help
Entry
Daud_1572         CDS       T00655                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daud_1572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1572
   00620 Pyruvate metabolism
    Daud_1572
   00640 Propanoate metabolism
    Daud_1572
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Daud_1572
   00680 Methane metabolism
    Daud_1572
Enzymes [BR:dau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Daud_1572
Lipid biosynthesis proteins [BR:dau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Daud_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1659125..1661107)
Genome map
AA seq 660 aa AA seqDB search
MAVKKETIETLLEESRIFHPDEQFTRQANVKNRDIYAEARANPRIFWAMQAERLDWYRKW
DQVLDWEPPFAKWFVNGKLNACYNCVDRHLNTWRKNKAAIIFEGEPGDSRILTYWDLWRE
VTQFANVLRMLGVRKGDRVAIYLPMIAEAAIAMLACARIGAPHSVVFGGFSAEALRDRIN
DAGAKLLITADGGWRRGKIVPLKRNADAALTECPSVDKVLVVKRTGQEVPMQDGRDYWYD
NLVVGVTVGGPCEEMDSEDMLFILYTSGTTGKPKGVVHTTGGYLTGVSTTHHMVFDIKDR
DVYWCTADVGWVTGHSYVVYGPLANGATTVIYEGAPDFPEFDRFWAIIERYGVNVFYTAP
TAIRAFMKWGEEWPARRDLSSLRLLGTVGEPINPEAWIWYHKHIGSERCPIVDTWWQTET
GMIMISALPGIISTKPGSASVPLPGVEIDVVDKEGNSVMLGKGGFLVIKEPWPAMLRTIY
GDNERYVREYWGKIPGHTLYFSGDGARRDYHNYFWILGRVDDVINVAGHRLSTMEIESAL
VDHPWVAESAAIGKAHDLKGQAISVFVTLKGKYFKELKDGSKTRAEFTSELKAHVVKKIG
AIARPDDIFLTAELPKTRSGKIMRRLLRDIAEGRALGDTTTLADPAVCRELKEKYESKES
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcaagaaggagactatcgaaaccctactcgaggagagccgcatatttcacccc
gacgagcagttcacccggcaggccaacgtcaagaaccgggacatttacgccgaggcccgg
gcgaacccgcggattttctgggcgatgcaggccgagcgtctggactggtaccgcaaatgg
gaccaggtcctggattgggagcccccgttcgccaaatggttcgtgaacgggaagctgaac
gcgtgttacaactgcgtcgaccggcacctcaacacctggcggaagaacaaggccgccatc
atctttgagggtgaaccgggggatagtcgaattctgacctattgggacctatggcgcgag
gtcacccagttcgccaatgtgctacgcatgttgggggtccggaagggcgaccgcgtggcc
atctacctgcccatgatcgccgaggcggctatcgccatgctggcctgcgcccggatcggc
gcgccccacagcgtggtgttcggagggttttccgccgaagcgctgcgcgaccgtatcaac
gacgccggggcgaagctcttgattactgcggacggcggctggcgccggggcaaaatcgtg
cctctgaagcggaacgccgatgcggccctgacggagtgcccgtccgtggacaaggtcctg
gtggtcaagcgcaccggccaggaagtgccgatgcaggatgggcgcgactactggtacgac
aacctggtggtcggggtgaccgtaggcgggccgtgtgaggaaatggactccgaggatatg
ctcttcattctgtatacgagcggtaccaccggcaagcccaagggtgtggtccatactacc
ggcggctacctgaccggggtttccaccacccaccatatggtcttcgacatcaaggatcgt
gatgtttactggtgcacggcggacgtcggctgggttaccgggcacagctacgtggtttac
ggaccgctggcgaacggggcgacgacggtgatttacgagggggcgcccgacttccccgag
ttcgaccgcttctgggcgatcattgagcgctacggggtgaacgtattctacaccgcgccc
acggccattcgggcctttatgaagtggggcgaggagtggcctgcccggcgcgatctttcc
agcctgcgccttttaggcacggtcggtgagccgatcaacccggaggcctggatctggtac
cacaagcacatcgggtcggaacggtgcccgattgtggatacctggtggcagaccgaaacc
gggatgatcatgatcagcgccctgccggggatcatctccacgaagccgggctcagcttcg
gtgccgctcccgggcgtagagatcgacgtggtcgacaaggaagggaactcggtgatgctg
ggcaaaggcggctttctggtgatcaaggagccctggccggccatgctccgcaccatttac
ggcgataacgagcggtacgtgcgcgagtactggggcaagattccgggccacaccctgtac
ttctccggggacggtgcgcgccgcgactatcacaactacttctggatcctgggccgggtc
gacgacgtgatcaacgtggccggacaccggctgagcaccatggaaatcgagagcgcgctg
gtcgatcacccctgggtggccgaatcggcagcgatcggcaaggcgcacgatctcaagggg
caggccatctcggtgttcgtgactttgaaagggaagtacttcaaggagctcaaggacggg
tcgaagacaagggccgaattcacgtccgaactcaaagcccacgtggtgaagaaaatcggg
gcgatcgcccggccagacgacatcttcctgaccgccgaactgccgaagaccagaagcggc
aagatcatgcggcgcctgctgcgggatatcgccgagggccgggccctgggcgacaccacc
accctggccgaccccgcggtctgccgggaactcaaggaaaagtacgagagcaaggaatct
taa

DBGET integrated database retrieval system