KEGG   Candidatus Desulforudis audaxviator: Daud_1839Help
Entry
Daud_1839         CDS       T00655                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daud_1839
   01230 Biosynthesis of amino acids
    Daud_1839
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1839
   00030 Pentose phosphate pathway
    Daud_1839
   00051 Fructose and mannose metabolism
    Daud_1839
  Energy metabolism
   00680 Methane metabolism
    Daud_1839
Enzymes [BR:dau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Daud_1839
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Daud_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1937994..1939106)
Genome map
AA seq 370 aa AA seqDB search
MDKTVTLSVIKADIGGFVGHSGVHPELLEKAKGILSGSPLLIDFHVTHVGDDINLILTHE
LGRNNGEIHQLAWDTFVACTEVAKKLKLYGAGQDLLGDAFSGNIKGLGPGVAEIEVVERK
SEPVIVLMADKTEPGAWNLPLYRIFADPFNTIGLVIDPNMHGGFNFEVRDLIAHKKIIFS
APEDIYDMLVFIGAPGRYAIKRVFHKANGQIAASSSTQRLNLMAGRYVGKDDPVCIIRCQ
SGFPAVGEVLEAFARPHLVSGWMRGSHSGPLMPVSVTNSCPTRFDGPPRVVALGFQLAQG
KLIGPQDMFDDPAFDRARALCNEIADYMRSLGPFEPHRLPLDEMEYTTMPLVMSKLKDRF
IDLRLSKTKS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacagtcacactctccgttatcaaagcggacattggtgggtttgtggggcat
tccggagtccacccggagttgctggaaaaggccaagggcattctctcgggcagcccgctg
ttgatagacttccacgtgactcacgttggtgacgatatcaacttgattctcacacacgag
ttgggacgcaacaacggcgagattcaccagttagcatgggacaccttcgtggcttgcacc
gaggtcgccaagaagctcaagctgtacggcgccggccaagatctcctgggggacgctttc
tcgggcaacatcaaggggcttggacccggtgtggcggagattgaggtcgtggagcgcaag
agcgagccggtcatcgtgctcatggccgacaagaccgagcccggcgcctggaacctgccg
ctctaccggatcttcgccgacccgttcaacaccattggcctggtgatagacccgaacatg
cacggcggcttcaacttcgaggtgcgcgacctcatcgcacataagaaaatcatcttctcc
gcgcctgaggacatttacgacatgctggttttcatcggcgcgcccgggcgctacgcgatc
aagcgggttttccacaaggccaacggtcagatcgcggcttcgtccagcacccagcggctg
aacctgatggccgggcgctacgtgggcaaggacgacccggtgtgcatcatccgctgccag
agcggcttcccggcggtcggcgaggtgctggaggcgttcgcccgcccgcacctggtctcc
gggtggatgcgcggttcccacagcgggccgctgatgcccgtttcggtcaccaattcctgc
ccaacccggtttgacggcccgccccgcgtggtggcgctgggcttccagttggcgcagggc
aagttgatcggcccacaggatatgttcgacgatcctgccttcgaccgggcgcgggccctg
tgcaacgaaatcgccgactacatgcggagcctcgggcccttcgaaccgcaccgcctgccc
ttggacgaaatggagtacacgacaatgcccctggtgatgtccaagctgaaggaccggttc
atcgacctcaggttgagcaagaccaagagctga

DBGET integrated database retrieval system