KEGG   Candidatus Desulforudis audaxviator: Daud_1839Help
Entry
Daud_1839         CDS       T00655                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dau01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dau01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dau00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dau00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dau00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:dau00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1937994..1939106)
Genome map
AA seq 370 aa AA seqDB search
MDKTVTLSVIKADIGGFVGHSGVHPELLEKAKGILSGSPLLIDFHVTHVGDDINLILTHE
LGRNNGEIHQLAWDTFVACTEVAKKLKLYGAGQDLLGDAFSGNIKGLGPGVAEIEVVERK
SEPVIVLMADKTEPGAWNLPLYRIFADPFNTIGLVIDPNMHGGFNFEVRDLIAHKKIIFS
APEDIYDMLVFIGAPGRYAIKRVFHKANGQIAASSSTQRLNLMAGRYVGKDDPVCIIRCQ
SGFPAVGEVLEAFARPHLVSGWMRGSHSGPLMPVSVTNSCPTRFDGPPRVVALGFQLAQG
KLIGPQDMFDDPAFDRARALCNEIADYMRSLGPFEPHRLPLDEMEYTTMPLVMSKLKDRF
IDLRLSKTKS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacagtcacactctccgttatcaaagcggacattggtgggtttgtggggcat
tccggagtccacccggagttgctggaaaaggccaagggcattctctcgggcagcccgctg
ttgatagacttccacgtgactcacgttggtgacgatatcaacttgattctcacacacgag
ttgggacgcaacaacggcgagattcaccagttagcatgggacaccttcgtggcttgcacc
gaggtcgccaagaagctcaagctgtacggcgccggccaagatctcctgggggacgctttc
tcgggcaacatcaaggggcttggacccggtgtggcggagattgaggtcgtggagcgcaag
agcgagccggtcatcgtgctcatggccgacaagaccgagcccggcgcctggaacctgccg
ctctaccggatcttcgccgacccgttcaacaccattggcctggtgatagacccgaacatg
cacggcggcttcaacttcgaggtgcgcgacctcatcgcacataagaaaatcatcttctcc
gcgcctgaggacatttacgacatgctggttttcatcggcgcgcccgggcgctacgcgatc
aagcgggttttccacaaggccaacggtcagatcgcggcttcgtccagcacccagcggctg
aacctgatggccgggcgctacgtgggcaaggacgacccggtgtgcatcatccgctgccag
agcggcttcccggcggtcggcgaggtgctggaggcgttcgcccgcccgcacctggtctcc
gggtggatgcgcggttcccacagcgggccgctgatgcccgtttcggtcaccaattcctgc
ccaacccggtttgacggcccgccccgcgtggtggcgctgggcttccagttggcgcagggc
aagttgatcggcccacaggatatgttcgacgatcctgccttcgaccgggcgcgggccctg
tgcaacgaaatcgccgactacatgcggagcctcgggcccttcgaaccgcaccgcctgccc
ttggacgaaatggagtacacgacaatgcccctggtgatgtccaagctgaaggaccggttc
atcgacctcaggttgagcaagaccaagagctga

DBGET integrated database retrieval system