KEGG   Candidatus Desulforudis audaxviator: Daud_1963Help
Entry
Daud_1963         CDS       T00655                                 

Definition
4Fe-4S ferredoxin
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dau01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dau00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dau00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dau00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dau00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dau00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:dau00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:dau00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dau00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2068583..2068777)
Genome map
AA seq 64 aa AA seqDB search
MYVTVKVEVEKCSGCKLCILSCPDPNVLAFIQEEKHVTVNEHRCKGCGLCASVCPEEALR
ISGN
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgttaccgtaaaagtggaagtggagaagtgtagcggctgcaagctctgcatcctg
tcgtgtccggatccgaacgtgctggcctttattcaggaggaaaagcacgtgacggtgaac
gagcaccgctgcaagggctgtggtttgtgcgcgtccgtgtgccccgaagaggcgcttagg
atcagcggtaattag

DBGET integrated database retrieval system