KEGG   Candidatus Desulforudis audaxviator: Daud_1964Help
Entry
Daud_1964         CDS       T00655                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00010  Glycolysis / Gluconeogenesis
dau00020  Citrate cycle (TCA cycle)
dau00620  Pyruvate metabolism
dau00633  Nitrotoluene degradation
dau00640  Propanoate metabolism
dau00650  Butanoate metabolism
dau00680  Methane metabolism
dau00720  Carbon fixation pathways in prokaryotes
dau01100  Metabolic pathways
dau01120  Microbial metabolism in diverse environments
dau01130  Biosynthesis of antibiotics
dau01200  Carbon metabolism
Module
dau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1964
   00020 Citrate cycle (TCA cycle)
    Daud_1964
   00620 Pyruvate metabolism
    Daud_1964
   00640 Propanoate metabolism
    Daud_1964
   00650 Butanoate metabolism
    Daud_1964
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Daud_1964
   00680 Methane metabolism
    Daud_1964
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Daud_1964
Enzymes [BR:dau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Daud_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Mtf2_C
Motif
Other DBs
NCBI-ProteinID: ACA60455
UniProt: B1I5X5
Position
complement(2068801..2069472)
Genome map
AA seq 223 aa AA seqDB search
MTKNSRKFIRMSGLGGQGVVTAAHILGMAAVKDGLKCSVNPFFGAEKRLAPAESYVRIAT
DDIWERGEVLFPNIIMIFHPHVITLGKCYTMPFFSGLQRGGKIIINSDQPLDLRAEELAG
LKDLGAEVYYVPATQVAAEAGGTALSTNIAMLGALLAVEALVSQEAIREAIAERFGGGKF
VASATTAALDDVLKSKFDRLAQLIEKNMAVVAAAQGSVSKYHY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaacagtagaaagttcatccgcatgtccggcctgggcgggcagggggtggtg
acagccgcgcacatactgggtatggcggccgtgaaggacgggctcaaatgctcggtcaac
ccctttttcggcgctgaaaaaagactggcgccggcggagagctatgtgcggattgcgacg
gatgacatctgggaacggggcgaggtgctctttccgaacatcatcatgattttccaccct
cacgtgattaccctgggcaagtgctacactatgccgtttttctccggcctgcagcggggt
gggaaaatcatcatcaactcggaccagccactggatttgcgggcggaggagttggcaggg
ctcaaagatctgggggccgaagtgtattacgtgccggccacccaagtggccgcggaggcg
ggggggacggccctgtcgacaaacatcgccatgctgggggctctgttggcggtggaggcg
ttggtctctcaggaagcgatccgggaggcgatcgcggaaaggttcggtggcggaaaattc
gtggcgtccgccacgacggcggcactggacgacgtgctgaagagcaagttcgaccgtctg
gcacagctgatcgagaaaaatatggcggtcgtggcggcggcccaaggcagcgtcagtaag
tatcattattag

DBGET integrated database retrieval system