KEGG   Candidatus Desulforudis audaxviator: Daud_1978Help
Entry
Daud_1978         CDS       T00655                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dau00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2082083..2082835)
Genome map
AA seq 250 aa AA seqDB search
MRDIVKEQDFLAARSSYEEARAVIVGAPLDATVSFRPGTRGGPAAVRAMSYCLEEYSLDL
KRDLRELAFHDLGDVLLPPGEVAVSLERIETVIARLFHDGKTPFLLGGEHLVTLPAVRAA
AARRPGLAVIQLDAHADLRDEYLGVAFSHATVMRRIGDFLGRQNLFQFGIRSADAPELEA
ARESGAFYTHRVLPGLVETVSALRDRPVYVSLDIDVVDPAFAPGVGTPEPAGITALLAAR
IVRDALLGMG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatatcgtcaaggaacaggattttctggcggcccggtcttcgtatgaagaagcg
cgggcggtgatcgtcggggccccgctggacgcgaccgtgtccttccggccgggcacccgc
ggggggccggccgcggtccgggccatgtcctactgcctggaagaatacagcctggatctc
aagcgtgatcttcgtgaactggccttccacgacctgggcgatgtcctcctgccacccggc
gaggtggcggtgagcctggagcgcattgaaaccgtcattgcccggctgttccacgacggc
aaaaccccctttctgctcggcggcgaacacctggtgaccctgcccgcggtccgggcggcg
gccgcccggcgcccgggactggccgtgatccaactcgacgcgcacgccgacctgcgtgac
gagtacctgggggtcgctttttcccacgcgacggtcatgcggcgcatcggcgatttcctg
gggcggcaaaacctgttccagttcgggatccggtccgccgacgcgccggagctggaagcg
gcgcgggagagcggggctttttatacccaccgcgtactaccggggctggtcgagacggtg
tcggcgctgcgggaccgtccggtttacgtttcactggacattgacgtcgtggacccggcc
ttcgcccccggcgtgggcacccccgaaccggccgggatcaccgccctgctggccgcccgg
atcgtccgcgacgccctactggggatgggttga

DBGET integrated database retrieval system