KEGG   Candidatus Desulforudis audaxviator: Daud_2043Help
Entry
Daud_2043         CDS       T00655                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:dau01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dau00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dau00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dau00650]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dau00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:dau00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:dau00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2152312..2154888
Genome map
AA seq 858 aa AA seqDB search
MTEDQAAVKKDIDDLVSRARNALEQFRGLGQERVDEIVRSAALAGLERHMELARMAVEET
GRGVYEDKILKNLYAVEYVYNSIRDRKTAGVVYEDPETGYREIAEPAGVIAALIPLTNPT
STTLFKGLIALKTRNPVVFSFHPGARRSSTAAAEALLEGAVAAGAPPECLLWIEDPTVEA
ARTLMRHPGVNLILATGGTAMVRAAYSAGIPALGVGPGNVPCYIHRTAHLERAVTDLILS
KTFDHGMICASEQALIVDRAVSNRVRELMEAAGCRFLNAGETRLLEQLATAGRTCSLNPQ
IVGKSPVDIARMAGFEVPEDTKILVAVQEGVGPDHPLSREKLSPVLAFYVVGDTGAAIER
AAEVVRYEGLGHTAVIHAADREVIESFSQRVPAGRIILNSPASQGALGDLYNVLTPSLTL
GCGYIGHNSTTDNVSAVHLVDIKRVAPRRAETQWFRVPPEIYFEPGSLSLLSQMPGLGRV
FLVTDEVLAELGYVDRVRRHLESRTEPVRLKVFSGVEPNPSLETVRRGTRRLGEFNPDTI
IALGGGSVIDAAKAMWLFHEYPEVRFEHLKLKFTDIRKRTYRLPARPRKTRLVAVPTTSG
SGSEVTAFAVITDRDRDIKYPLADYALTPDVAIVDVDLAMGQPPALTADAGMDVLGHALE
AYVSVRASDFTDPPAIKAIEAVFRYLPRAYRNPGDREAREKMHTAATLAGMAFTNAFLGV
NHSLAHKLGNEFNLPHGRAVAVLMPHVIEYNAEVPAKYASYPNYGYYRAAERYQEIARHL
GLPASTAAEGSAGLAETVRRLIAELDLPPTIAACGVPRDRFEARLALLAEKAYEDQTTVT
NPRQPLISELIALYRRAY
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagatcaggcggcagtgaagaaagacatcgacgatctggtgtctcgggctcgg
aacgcgctggagcagttccgcgggctgggccaggagcgggtggacgagatcgtccggtcc
gccgccctggccgggctggagcggcacatggaactcgcccggatggccgttgaggaaacc
ggccgtggggtgtacgaggataagattctcaagaatctctacgccgtggagtacgtctac
aacagtatccgggaccggaaaacggccggggtggtctacgaggacccggaaaccggttac
cgggaaatcgccgagccggccggggtgatcgcggccctgattccgctgaccaaccctacc
tcgaccaccctgttcaagggcctgatcgccctgaaaaccagaaacccggtggtgttcagt
ttccaccccggagccaggcgctccagtaccgccgccgccgaggccctgctggaaggtgcc
gtggccgccggcgccccgccggaatgcctgctctggatcgaggacccgacggtagaggcg
gcccggacgctgatgcgccaccccggggtgaacctgattctggccaccggggggaccgcc
atggtgcgcgccgcgtacagcgccggcatcccggcactgggcgtcggccccggaaacgtg
ccctgctacattcaccggaccgcccacctggagcgggcggtgaccgacctgatcctgagc
aagaccttcgatcacgggatgatctgtgcctcggaacaggcgctgattgtggaccgggct
gtttccaaccgggtaagggagttgatggaggccgcgggctgccggttcctgaacgccggg
gaaacccggctcctggagcagctggccaccgccggccggacatgctccctgaacccgcaa
atcgtgggcaaaagcccggtggacattgcccgcatggccggtttcgaggtacccgaggac
acgaaaatcctggtggccgtgcaggaaggcgtcggccccgaccacccgctctcccgggaa
aaactcagcccggtgctggccttctacgtggttggcgataccggcgccgccatcgagcgg
gccgcggaagtggtgaggtacgaaggtctgggccatacagcggtgatccacgccgccgac
cgggaggtgattgaaagtttttcgcagcgggtgccggccgggcggatcattttgaactcc
ccggccagccagggtgccctgggcgacctgtacaacgtgctcaccccgtcgcttaccctg
ggctgcggctacatcggtcacaactccaccaccgacaacgtcagcgccgtccacctggtg
gacatcaagcgggtcgcgccgcgccgcgccgaaacccagtggttccgggtgccgccggaa
atctactttgagcccggctccttgagcctcttaagccagatgccaggcttagggcgggtg
ttcctggtcacggacgaagtgctcgccgaactgggttacgtggaccgcgtgcgccggcac
ctggagagccggaccgaaccggtccggctcaaggtgttctccggcgtggaaccgaacccc
tccttagaaacggtgaggcggggcaccaggcgtctgggggaattcaaccccgacaccatc
atcgccctgggcggcggttcggtcatcgacgccgccaaggcaatgtggcttttccacgag
tatcccgaggtccgctttgagcacctgaagttaaaattcacggatatccggaagcgcact
taccgcctgcccgcgcggccgcggaaaacccggctggtggccgtgccgaccacctccggg
agcggctccgaggtcaccgcctttgcggtgatcaccgaccgggaccgggacatcaagtac
ccgttggccgactacgccctgacccccgacgtggccatcgtcgatgtcgatttggcgatg
ggtcagcccccggcgcttaccgccgacgccggcatggacgttctgggccacgccctagaa
gcctacgtttcggtgcgggcgtccgatttcaccgaccccccggccataaaggccattgaa
gcggtcttccggtacctgccccgggcctatcgcaaccccggcgaccgcgaggcccgggag
aaaatgcacaccgccgccaccctggccggaatggctttcaccaacgcctttctgggcgtc
aatcacagcctggcgcacaagctcggaaacgaattcaaccttccgcacgggcgcgccgtc
gccgtgctcatgccccacgtgattgagtataacgcggaggtaccggccaagtacgcctcc
tatccgaactacgggtactaccgggccgcggagcgttaccaggaaatcgcccggcacctg
gggctcccagcgtcaaccgccgcagaggggtcggccggcctggcggaaaccgtgcggcgc
ctgatcgcggaacttgacctgcccccgaccatcgccgcctgcggcgtgccgcgggaccgg
ttcgaggcccggctggccctgctggccgaaaaggcttatgaagatcagacgacggtgacc
aacccccgccagcccctgatctccgaactgattgcactttaccgccgggcctattga

DBGET integrated database retrieval system