KEGG   Candidatus Desulforudis audaxviator: Daud_2043Help
Entry
Daud_2043         CDS       T00655                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Daud_2043
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_2043
   00620 Pyruvate metabolism
    Daud_2043
   00650 Butanoate metabolism
    Daud_2043
  Lipid metabolism
   00071 Fatty acid degradation
    Daud_2043
  Amino acid metabolism
   00350 Tyrosine metabolism
    Daud_2043
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Daud_2043
   00626 Naphthalene degradation
    Daud_2043
Enzymes [BR:dau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Daud_2043
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Daud_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2152312..2154888
Genome map
AA seq 858 aa AA seqDB search
MTEDQAAVKKDIDDLVSRARNALEQFRGLGQERVDEIVRSAALAGLERHMELARMAVEET
GRGVYEDKILKNLYAVEYVYNSIRDRKTAGVVYEDPETGYREIAEPAGVIAALIPLTNPT
STTLFKGLIALKTRNPVVFSFHPGARRSSTAAAEALLEGAVAAGAPPECLLWIEDPTVEA
ARTLMRHPGVNLILATGGTAMVRAAYSAGIPALGVGPGNVPCYIHRTAHLERAVTDLILS
KTFDHGMICASEQALIVDRAVSNRVRELMEAAGCRFLNAGETRLLEQLATAGRTCSLNPQ
IVGKSPVDIARMAGFEVPEDTKILVAVQEGVGPDHPLSREKLSPVLAFYVVGDTGAAIER
AAEVVRYEGLGHTAVIHAADREVIESFSQRVPAGRIILNSPASQGALGDLYNVLTPSLTL
GCGYIGHNSTTDNVSAVHLVDIKRVAPRRAETQWFRVPPEIYFEPGSLSLLSQMPGLGRV
FLVTDEVLAELGYVDRVRRHLESRTEPVRLKVFSGVEPNPSLETVRRGTRRLGEFNPDTI
IALGGGSVIDAAKAMWLFHEYPEVRFEHLKLKFTDIRKRTYRLPARPRKTRLVAVPTTSG
SGSEVTAFAVITDRDRDIKYPLADYALTPDVAIVDVDLAMGQPPALTADAGMDVLGHALE
AYVSVRASDFTDPPAIKAIEAVFRYLPRAYRNPGDREAREKMHTAATLAGMAFTNAFLGV
NHSLAHKLGNEFNLPHGRAVAVLMPHVIEYNAEVPAKYASYPNYGYYRAAERYQEIARHL
GLPASTAAEGSAGLAETVRRLIAELDLPPTIAACGVPRDRFEARLALLAEKAYEDQTTVT
NPRQPLISELIALYRRAY
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagatcaggcggcagtgaagaaagacatcgacgatctggtgtctcgggctcgg
aacgcgctggagcagttccgcgggctgggccaggagcgggtggacgagatcgtccggtcc
gccgccctggccgggctggagcggcacatggaactcgcccggatggccgttgaggaaacc
ggccgtggggtgtacgaggataagattctcaagaatctctacgccgtggagtacgtctac
aacagtatccgggaccggaaaacggccggggtggtctacgaggacccggaaaccggttac
cgggaaatcgccgagccggccggggtgatcgcggccctgattccgctgaccaaccctacc
tcgaccaccctgttcaagggcctgatcgccctgaaaaccagaaacccggtggtgttcagt
ttccaccccggagccaggcgctccagtaccgccgccgccgaggccctgctggaaggtgcc
gtggccgccggcgccccgccggaatgcctgctctggatcgaggacccgacggtagaggcg
gcccggacgctgatgcgccaccccggggtgaacctgattctggccaccggggggaccgcc
atggtgcgcgccgcgtacagcgccggcatcccggcactgggcgtcggccccggaaacgtg
ccctgctacattcaccggaccgcccacctggagcgggcggtgaccgacctgatcctgagc
aagaccttcgatcacgggatgatctgtgcctcggaacaggcgctgattgtggaccgggct
gtttccaaccgggtaagggagttgatggaggccgcgggctgccggttcctgaacgccggg
gaaacccggctcctggagcagctggccaccgccggccggacatgctccctgaacccgcaa
atcgtgggcaaaagcccggtggacattgcccgcatggccggtttcgaggtacccgaggac
acgaaaatcctggtggccgtgcaggaaggcgtcggccccgaccacccgctctcccgggaa
aaactcagcccggtgctggccttctacgtggttggcgataccggcgccgccatcgagcgg
gccgcggaagtggtgaggtacgaaggtctgggccatacagcggtgatccacgccgccgac
cgggaggtgattgaaagtttttcgcagcgggtgccggccgggcggatcattttgaactcc
ccggccagccagggtgccctgggcgacctgtacaacgtgctcaccccgtcgcttaccctg
ggctgcggctacatcggtcacaactccaccaccgacaacgtcagcgccgtccacctggtg
gacatcaagcgggtcgcgccgcgccgcgccgaaacccagtggttccgggtgccgccggaa
atctactttgagcccggctccttgagcctcttaagccagatgccaggcttagggcgggtg
ttcctggtcacggacgaagtgctcgccgaactgggttacgtggaccgcgtgcgccggcac
ctggagagccggaccgaaccggtccggctcaaggtgttctccggcgtggaaccgaacccc
tccttagaaacggtgaggcggggcaccaggcgtctgggggaattcaaccccgacaccatc
atcgccctgggcggcggttcggtcatcgacgccgccaaggcaatgtggcttttccacgag
tatcccgaggtccgctttgagcacctgaagttaaaattcacggatatccggaagcgcact
taccgcctgcccgcgcggccgcggaaaacccggctggtggccgtgccgaccacctccggg
agcggctccgaggtcaccgcctttgcggtgatcaccgaccgggaccgggacatcaagtac
ccgttggccgactacgccctgacccccgacgtggccatcgtcgatgtcgatttggcgatg
ggtcagcccccggcgcttaccgccgacgccggcatggacgttctgggccacgccctagaa
gcctacgtttcggtgcgggcgtccgatttcaccgaccccccggccataaaggccattgaa
gcggtcttccggtacctgccccgggcctatcgcaaccccggcgaccgcgaggcccgggag
aaaatgcacaccgccgccaccctggccggaatggctttcaccaacgcctttctgggcgtc
aatcacagcctggcgcacaagctcggaaacgaattcaaccttccgcacgggcgcgccgtc
gccgtgctcatgccccacgtgattgagtataacgcggaggtaccggccaagtacgcctcc
tatccgaactacgggtactaccgggccgcggagcgttaccaggaaatcgcccggcacctg
gggctcccagcgtcaaccgccgcagaggggtcggccggcctggcggaaaccgtgcggcgc
ctgatcgcggaacttgacctgcccccgaccatcgccgcctgcggcgtgccgcgggaccgg
ttcgaggcccggctggccctgctggccgaaaaggcttatgaagatcagacgacggtgacc
aacccccgccagcccctgatctccgaactgattgcactttaccgccgggcctattga

DBGET integrated database retrieval system