KEGG   Candidatus Desulforudis audaxviator: Daud_2091Help
Entry
Daud_2091         CDS       T00655                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Daud_2091
   00052 Galactose metabolism
    Daud_2091
   00500 Starch and sucrose metabolism
    Daud_2091
   00520 Amino sugar and nucleotide sugar metabolism
    Daud_2091
Enzymes [BR:dau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Daud_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2204994..2205854)
Genome map
AA seq 286 aa AA seqDB search
MGVKKAVIPAAGLGVRFLPATKSQPKEMIPIIDKPTIQYIIEEALASGIEDILIISGRGK
RAIEDHFDHAPELEAHLAAKGKAAELAEVRRISDMGNIHYVRQRHPLGLGHAVGCARAFV
GDEPFAVLLGDDIVRGAVPCLKQLLEQHAKLGASVVALEEVPLEDVSKYGVIQGRAAGPR
LFAVEDLVEKPPVDQAPSRMAVMGRYVLDPRIFPLIEQTRPGAGGEIQLTDALRLLVREQ
PLYGYQFEGRRYDVGHCLGYLKATVDFALERDEVREPFLEYLRGKV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaaagaaggcagtgattccggcggccgggctgggagtccggttcctacccgcc
accaagtcccaacccaaagagatgatcccgatcatcgacaaaccgaccatccagtacatc
atcgaagaggctttggcctcgggcatcgaggatatcctcatcatttccggacgcggcaaa
cgggccattgaagaccatttcgaccacgccccggagctggaggcccacctggcggcgaag
gggaaggccgcggagttggccgaggtccggcggatcagtgacatgggcaacatccactac
gtccggcagcggcatcccctggggctggggcacgccgtggggtgcgcccgggcctttgtg
ggcgacgagccatttgcggtgctgctgggggacgacatcgtgcgcggcgcggtgccctgc
ctgaagcaactgctggagcagcacgccaagctcggcgctagtgtagtggccctggaggaa
gtgccgctcgaagatgtgagcaagtacggggtgatccagggccgcgccgccgggccacgg
cttttcgcggtggaggacctggtggaaaagccgccggtggatcaggcgccgtcccggatg
gcggtgatggggcgctatgtcctggacccgcgtattttccccctgatcgagcaaaccagg
cctggcgccgggggtgagattcagctcactgacgccttgcgcctgctggtccgggaacag
cccctttacggctaccagtttgagggacggcgttacgacgtcggccactgccttggttac
ctgaaggccaccgttgatttcgccctggagcgtgatgaggtgcgcgagccgtttctggaa
tacctgcgcggaaaagtttga

DBGET integrated database retrieval system