KEGG   Candidatus Desulforudis audaxviator: Daud_2189Help
Entry
Daud_2189         CDS       T00655                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00860  Porphyrin and chlorophyll metabolism
dau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daud_2189
Enzymes [BR:dau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     Daud_2189
    6.3.5.11  cobyrinate a,c-diamide synthase
     Daud_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA DEC-1_N MobB
Motif
Other DBs
NCBI-ProteinID: ACA60676
UniProt: B1I6M8
Position
complement(2302167..2303564)
Genome map
AA seq 465 aa AA seqDB search
MEGRPRVVIAAPQGRSGKTTVTAALIAALRGRGLAVQPFKKGPDFIDPSWLTRVAGRSCR
NLDRFLMDEPTLAGSFMRATADADIAVIEGAMGLFDGVDVEGSGSTAEIARILKAPVILV
VNAVRMTRSAAAVVLGCRMFDPRVHLAGVVFNNVARQRHRDLLTASVEHYCRIPVLGAMP
KNRSYEVPDRHLGLIPAGEDEHLLGAVHAWTADAETFLDVDRILEIARAAPPLPAPPPLP
AAVAPAGGRPLIGVIRDRAFSFYYPENLEALERAGAGLVYINALHDGLPDVDGLYVGGGF
PEVFAAELEANVRLRRAVRERVESGLPVYAECGGLMYMGRRLTWKGKSYAMTGALPFEVD
LDERPRGHGYMIVDVVGDNPYFPVGTTIRGHEFHHSRVHALDTGTARLAFRVRKGYGVDG
EWDGIVYRNVLAAYKHIHALSVPGWAPGFVLRAAAYSAQKNKEVP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggcaggccgcgggtggtcattgccgcaccgcagggccggtcgggaaaaacaacg
gttaccgctgcgctgatcgccgccctgcgtgggcggggactcgcggtccagccgttcaaa
aagggtcccgacttcattgacccgagctggttgacgcgggttgccggccggagttgccgc
aacctggaccgtttcctgatggacgaaccgacactggccggttcgtttatgcgggcgacg
gcggatgcggacatcgccgtaatcgaaggggcgatgggcctgtttgacggtgtggacgtg
gagggaagcggcagcaccgcggagattgcgcggattttgaaagcgccggtcatcctggtg
gtgaatgcggtgcgcatgacccgcagcgccgccgcggtcgtgcttggctgccggatgttt
gacccgcgggtgcacctggccggtgtggtgtttaacaacgtcgcccggcagcggcaccgg
gatctgctgacggcgtctgtcgagcactactgccggatcccggtgctgggtgccatgccg
aaaaacaggtcctacgaggtgcccgaccggcacctgggcctgattccggccggtgaggac
gagcacctgctcggcgcggtgcatgcctggaccgccgacgcggagacctttctagacgtt
gaccgcattctggaaatcgcccgtgcggcgccgccgcttcccgcacccccgccgttgccg
gccgccgtggcaccggccggcggccggccgctgatcggggtgatccgggaccgggccttc
agcttctactatcccgagaatctggaggccctggaacgggccggcgccggactggtttac
atcaacgccctgcacgacggtctcccggacgtggacgggctttatgtcggcggcggcttc
ccggaggtgttcgccgccgagctggaggccaatgtgcgcctgcgccgggccgtccgtgaa
cgggtcgagtccgggttgcccgtgtacgccgaatgcggcgggctgatgtacatgggacgg
aggcttacctggaaagggaaaagctacgccatgaccggggcactgccctttgaggtcgat
ctggacgagcggccccggggtcacgggtacatgattgtggacgtcgttggggacaatccc
tactttccggttgggaccaccatcagggggcacgagtttcaccactcgcgggtgcacgcc
ctggacaccgggaccgcccggctggcgttccgggtccggaaaggatacggtgtagacggc
gagtgggatgggatcgtttaccgaaacgtactggcggcctacaagcacattcacgccctg
tccgttcccggatgggcgcctgggtttgtgctgcgggccgccgcttacagtgctcagaag
aacaaggaggttccataa

DBGET integrated database retrieval system