KEGG   Desulfomicrobium baculatum: Dbac_0020Help
Entry
Dbac_0020         CDS       T00963                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dba  Desulfomicrobium baculatum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dbac_0020
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dbac_0020
Enzymes [BR:dba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dbac_0020
Two-component system [BR:dba02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dbac_0020
Bacterial motility proteins [BR:dba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dbac_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34251..34841)
Genome map
AA seq 196 aa AA seqDB search
MKRAFKAVVVGVSSGGLEALKIFVPGLRKDLAVPVLIVQHLSPQADSYLPARLDEVSGLT
VKEAEDKELLQAGVAYVAPPDYHLLVEADGSLTLSVDPKVNFSRPSVDVLFETASDAFGA
ALIGVVLTGANQDGAKGLARIKRRGGVAIVQSPESAQAEAMPRAALESTNVDHVLPLRDI
APFLNNLIGPSHDNTT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagcgttcaaggcagtggtcgtcggagtctcttccggggggcttgaagccctc
aagatttttgtcccgggactgcgcaaggatctggccgtgccggtcctcatcgtgcagcac
ctctcgccgcaggcggactcctatctgcctgcgcgcctggacgaggtgagcggactcacc
gtcaaggaggccgaggacaaggagctgttgcaggccggcgtggcgtacgtggcgccaccc
gattatcacctgctggtggaggcggacgggagcctgaccttgagcgtggacccgaaagtg
aatttctcacggccctcggtggatgtactgttcgagaccgcgtccgacgctttcggagcc
gcgctcatcggcgtagtcctgactggggccaaccaggacggagccaaaggactggcccgc
atcaagcgccggggaggggtggccatcgtgcagtcaccggaatcggcccaggcagaagcc
atgccaagggccgccctggagtccaccaacgtggaccatgttttgcccctacgcgacatc
gccccctttctgaacaacctgattggaccgagccatgacaacaccacttga

DBGET integrated database retrieval system