KEGG   Desulfomicrobium baculatum: Dbac_0196Help
Entry
Dbac_0196         CDS       T00963                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dba  Desulfomicrobium baculatum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dbac_0196
DNA repair and recombination proteins [BR:dba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dbac_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229676..230281
Genome map
AA seq 201 aa AA seqDB search
MQRLPAPLQKIVDQFSALPGVGPKSALRMALTLLKWPEESVRSFGRDIEGLRSALHICSR
CCGLADSDPCHLCADPKRTPEQLCLVSEWDSLMVMEESGIFKGRYLILGGLLSPLDGIDA
RSLEMDKLESILREGQVREVILALGSTMEAEATGSYVHNLLTRSFPDVAVTRLAQGIPLG
SELKYVDRETLKQSLKHRQSL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgccttcccgcccctttgcaaaagatagttgatcagttttcggccctgcccggg
gtggggccgaaaagcgccttgcgcatggccctgaccctgctcaaatggcccgaggagtcc
gtgcgttcctttggccgggacatcgagggcctgcgcagcgccctgcatatctgctcgcgg
tgctgcggcctggccgacagcgatccctgccatctctgcgcagaccccaagcggacgccg
gaacagctctgcctggtctcggaatgggacagcctcatggtcatggaggaatccggcatc
ttcaagggccgttatctgatcctgggcggcctgctttctcccctggacgggatcgatgcc
aggtcgctcgagatggacaagctcgaatccatcctgcgcgaggggcaggtgcgcgaagtc
atcctggccctgggttcgaccatggaggccgaagccacggggtcctatgtgcacaacctg
ctgacgcgcagctttccggacgttgccgtgacccgtctggcccagggcattccgctgggc
tcggagctcaagtacgtggaccgcgaaaccctgaaacagtccctcaaacacaggcagtcc
ctgtag

DBGET integrated database retrieval system