KEGG   Desulfomicrobium baculatum: Dbac_0197Help
Entry
Dbac_0197         CDS       T00963                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dba  Desulfomicrobium baculatum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230286..232460
Genome map
AA seq 724 aa AA seqDB search
MCSIQGEVITVVYHNPDNGYVIARLDSPSEPGQVNVVGLLGDVAPGESLRLTGEWVEHPK
FGRQFKAESCEHLLPASINGIRRFLGSGAVKGIGEKTADRLISRFGSQILDIMDSDPEQL
LEVEGIGPAKLKTIVSSWQEKREVRGLMLFLQTHGVATTFAHRIFRHYGVNAVQRLRANP
YDLAYDIHGIGFRTADEVALKLGFAEDAPQRLEAGVEYCLRQTADGAGHMFLPRPTLAEE
AAKLLGCHDLELIEEQIDALAERKRLVIEPLPEKGVAEAVFLTYFYRTEREIASRLQGLL
DHVSRLDPQKISKAVEREEQRQSLTLSEEQRAAVESACGHKVSIITGGPGTGKTTITRVV
VRALKALGLKISLAAPTGRAAKRLAEATGFTATTLHRLLRYQPATGFEFNEEKKLSADVM
VVDEVSMLDCGLCLSLLRALPLTCRLVFVGDENQLPSVGAGNVLGDMIESGVVPAVRLTH
IYRQARESMIVVNAHRINEGEFPLGSPEAPPKADFFWVEKENLIELQALVLRMVCERIPE
AYGLDPMTDVQVLTPMHKGEVGTVALNRLLQERLNPDGRELVRGQRAYRVGDRILQLRNN
YDKEVFNGDLGRILAIDTEDETLHAEFDGREVEYGFDELDEIGLAYAISVHKSQGSEYPA
VVMPVVSQHYMLLQRNLIYTGLTRARKLAVLMGSRRAMHMGLGNERGRQRHTSLAVRLAK
EGQI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcatacagggcgaagtcattaccgtcgtctaccacaatcccgataacgggtac
gtcatcgcgcggctggattcgccgtccgagcccggccaggtcaacgtggtcgggctgctg
ggcgatgtggctccgggtgaatccctgcgcctgaccggcgagtgggtcgagcatcccaag
ttcggacggcagttcaaggccgagtcctgcgagcatcttctgcctgcgtccataaacggc
atccgccgctttctgggctccggcgcggtcaagggcatcggcgagaaaaccgccgaccgc
ctgatcagccgcttcggcagccagattctcgacatcatggattcggaccccgagcagctg
ctggaagtggagggcatcggcccggccaaattgaagaccatagtctcgtcctggcaggag
aagcgggaagtgcgcgggctgatgctctttttgcagacccacggcgtagccacgaccttc
gcccaccgcatcttccgtcattacggggtcaacgccgtgcagcgcctgcgggccaatccc
tatgatctggcctacgacatccatggcatcgggttccgcaccgccgacgaggtggccttg
aagctcggctttgccgaggacgcgccccagcgtctggaggccggggtggaatactgcctg
cgccagacggcggatggggcggggcacatgttcctgccgcgtcccacgctggcggaggag
gcggccaagctgctgggctgccatgacctggagctgatcgaggagcagatcgacgccctg
gccgagcgcaagcgtctggtgatcgagcccttgccggaaaagggcgtggccgaggccgtt
tttctgacctatttctaccgcaccgagcgcgagatcgcgtcgcgcctgcagggcctcctg
gatcatgtcagccgcctcgacccgcagaagatatcaaaagccgtggagcgtgaggagcag
cgccagtccctgaccctgtcggaagagcagcgcgcggcggtggagtcggcctgcgggcac
aaggtgtccatcatcaccggcgggccgggcacgggcaagacgaccatcacccgtgtcgtg
gtgcgggccttgaaagccctggggctgaagatttccctggccgcgcccacgggccgggcc
gccaaaaggctggccgaggccaccgggttcacggccacgaccctgcaccgcctgctgcgt
tatcagccggccactgggttcgagttcaacgaggagaagaaactctccgccgacgtcatg
gtcgtggacgaggtttccatgctcgactgcggtctgtgcctgtcgctcctgcgcgccctg
cccctgacctgccgcctggttttcgtcggcgatgagaatcagctgccgtcggtgggcgcg
ggcaacgtgctcggggacatgatcgaaagcggcgtggtcccggccgtgcgcctgacgcac
atctaccgccaggcgcgggagagcatgatcgtggtcaacgcccaccgcatcaacgagggc
gagtttcccctcggcagcccggaggctccgcccaaggccgatttcttttgggtcgagaaa
gagaatctcattgaactgcaggccctggtcctgcgcatggtctgcgagcgcatccccgaa
gcgtacggccttgatcccatgaccgacgtgcaggtgctcacccccatgcacaagggcgag
gtcggtaccgtggccctgaaccgcctgctgcaggaacgcctcaatccggatggccgggaa
ctggtgcgcggccagcgtgcctatcgggtcggggaccgcattctgcaactcaggaacaac
tacgacaaggaagtcttcaacggcgaccttggccgcatcctggccatcgacaccgaagac
gagaccttgcatgcggaattcgatggccgggaggtggagtacgggttcgacgaactcgac
gagatcggtctggcctacgccatcagcgtgcacaagagccagggcagcgagtatccggcc
gtggtcatgccggtggtctcgcagcactacatgctcctgcagagaaatctcatctacacc
ggattgaccagagccaggaagctggccgtgctcatgggctcgcgccgcgccatgcacatg
ggcctgggcaacgagcgcgggcggcaacgccatacgtctctggccgtgcgcctggcaaaa
gagggtcaaatctag

DBGET integrated database retrieval system