KEGG   Desulfomicrobium baculatum: Dbac_0258Help
Entry
Dbac_0258         CDS       T00963                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dba  Desulfomicrobium baculatum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dbac_0258
   00052 Galactose metabolism
    Dbac_0258
   00500 Starch and sucrose metabolism
    Dbac_0258
   00520 Amino sugar and nucleotide sugar metabolism
    Dbac_0258
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dbac_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303790..304662
Genome map
AA seq 290 aa AA seqDB search
MQVRKVVIPVAGWGTRSLPATKNVPKEILPVFRKPSIQYIVEEAIASGLSDVVFVNNQNK
RIIEDHFDYNLALEQLLERKGQLDLLEEVRKVAMMANIIVVRQKEQLGLGHAVLCAREVI
KDEPFAVMVGDDLMFNRDPGINQLLEVWKNERMPVVGVMEVPRDKVSKYGIIDAEEFAPG
LYRIRGVKEKPDMESAPSRLALVGRYVLTPEIFDHLEGVKPDKTGEIQLTDALQSMARDN
RLLAVKLRGQRFDVGDWVDYLTANIYFALQDEDLRYDLIARLRELIPPSR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtacgtaaagttgtcattccggtggcggggtggggaacaagatcacttccggcg
accaaaaatgtgcccaaggaaatcttgccggtattccgaaagccttccattcaatatata
gtggaagaagcaatagcttccggcctgtcggatgtggttttcgtcaacaaccagaacaag
cgtatcatcgaggatcatttcgactacaacctcgccctggagcagctgctggaacgcaag
ggccagctggatctgctggaggaagtgcgcaaggtggccatgatggccaacatcatcgtc
gtgcgccagaaggagcagctgggcctgggccatgcggtgctgtgcgcgcgcgaggtcata
aaggacgagcccttcgcggtcatggtcggcgacgacctcatgttcaatcgcgatcccggc
atcaaccagctgcttgaggtctggaagaacgagcgcatgcccgtggttggagtcatggag
gttccgcgcgacaaggtcagcaaatacggcatcatcgacgccgaggaatttgcgccgggc
ctgtaccggattcgcggggtcaaggaaaagccggatatggaaagcgcgccgtccagattg
gctctggtgggacgctatgtgctgaccccggaaatattcgaccatctggaaggcgtgaag
cccgacaagaccggcgagattcagttgaccgacgcactgcagtccatggcccgcgacaat
cgccttttggccgtgaagctgcgcggacagcgcttcgatgtcggcgactgggtcgactac
ctgaccgccaatatctatttcgccctgcaggacgaggatctgcgctacgatctcatcgcc
cgcctgcgcgaactcatcccgccttcccgctaa

DBGET integrated database retrieval system