KEGG   Desulfomicrobium baculatum: Dbac_0880Help
Entry
Dbac_0880         CDS       T00963                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00010  Glycolysis / Gluconeogenesis
dba00051  Fructose and mannose metabolism
dba00562  Inositol phosphate metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01130  Biosynthesis of antibiotics
dba01200  Carbon metabolism
dba01230  Biosynthesis of amino acids
Module
dba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_0880
   00051 Fructose and mannose metabolism
    Dbac_0880
   00562 Inositol phosphate metabolism
    Dbac_0880
Enzymes [BR:dba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dbac_0880
Exosome [BR:dba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dbac_0880
  Exosomal proteins of bladder cancer cells
   Dbac_0880
  Exosomal proteins of melanoma cells
   Dbac_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACU88998
UniProt: C7LPF5
Position
961655..962410
Genome map
AA seq 251 aa AA seqDB search
MKKLLMAANWKMYKSVEEGVATARELVSLLDKLPEDREVLVCPSFIMMHSVCPILAQKAG
CYAGAQNFYPAAQGAFTGEVAPEQLMGLGCTHALAGHSERRHVLGEMDELIGRKVAFGLD
AGLKMILCIGETIVERRLGQIEEVLARQLESGLAGVLSTATAQNLAVAYEPVWAIGTGEV
AGPDEILAAHAFVRATLTSLLPKEGAQIRILYGGSVKPDNAATIIRLDNVDGVLVGGASL
KADSFSQIVLA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctcatggccgccaattggaagatgtacaagagcgtggaagagggcgtg
gccacggccagggaactggtctcgctgctcgacaaactgcccgaggacagggaagtgctc
gtctgcccgtcttttatcatgatgcattccgtgtgtcccattcttgcgcagaaagcggga
tgttacgccggagcccagaatttctatcccgctgcccagggggcttttacaggtgaagtc
gcgcctgagcagcttatgggcctgggctgcacgcatgccctggcaggacactccgagcgc
aggcacgtcctgggcgaaatggatgagcttatcgggcgcaaggtggcatttggactggat
gccgggctcaagatgatcctgtgcatcggcgagaccattgtcgagcggcgactgggacag
atcgaggaagttttggcgcgccaactcgaaagcgggctggccggagtgctgtccaccgcc
actgcacagaacttggctgtggcctacgagccggtctgggccatcggcacgggcgaagtc
gccggacccgatgagattctggccgcgcatgcctttgtgcgtgccacgctcacgtcgttg
ttgcccaaagagggcgctcaaatccgcattctttacggcggttccgtcaagccggacaac
gccgcgaccatcatccgccttgacaatgtggacggtgtgctggtaggcggcgcaagtctc
aaagcggacagtttcagtcagatcgtgctcgcataa

DBGET integrated database retrieval system