KEGG   Desulfomicrobium baculatum: Dbac_0961Help
Entry
Dbac_0961         CDS       T00963                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dbac_0961
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dbac_0961
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dbac_0961
Enzymes [BR:dba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dbac_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1042130..1043338
Genome map
AA seq 402 aa AA seqDB search
MTMPTADGFFGTYGGQFVPEPIKDILNELAEAFERYRNDPDFIKEYEYYQKQFTGRPNPL
YFCANLTSRCGGAKIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKIIAETGAGQHGVA
TAATAALMGMECTIHMGAVDVERQKLNVFRMQMMGARVVPAESGQKTLKEAVDEALMSWV
QDAQNTYYLLGSAVGPHPYPLMVREFQSIVGREAKAQILEAEGRLPDYCIACVGGGSNAM
GLFSEFIPHKEVRLVGVEPAGRGLGYGEHAATLCLGEPGVMHGFNSYMLKDETGEPAEVY
SISAGLDYPSVGPEHAHLKDLGRAEYVHASDKEALDAFFLLSRTEGIIPALESSHALAHA
LRIAPTLSADTIIIVNLSGRGDKDVDQIERMVESGEIVPPVL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcccacagccgacggtttttttggcacctacggtggacagttcgtccccgaa
ccgatcaaggacatcctgaacgaactggccgaggcctttgagcgttaccgcaatgatccg
gatttcatcaaggaatacgaatactaccagaagcagttcacgggccgtcccaatccgctc
tacttctgcgccaacctgaccagccgctgcggcggggccaagatctacctcaaacgcgag
gacctgaaccacctcggcgcgcacaaggtcaacaacaccatcggccagattctgctggca
aaacgtatgggcaagaagaagatcatcgccgagaccggcgcggggcagcacggcgtggcc
acggcggccaccgccgcgctcatgggcatggagtgcaccatccacatgggcgcggtggat
gtggagcgccagaagctcaacgtcttccgcatgcagatgatgggggccagggtcgtgccc
gccgagagcggccagaagaccctgaaggaggccgtggacgaggcgctgatgtcctgggtt
caggatgcccagaatacctactatctgctcggctccgccgtgggtccgcatccgtacccg
ctcatggtgcgggagttccagtccatcgtcggtcgggaagccaaggcccagatcctggag
gccgaagggcgcctgcccgattactgcatcgcctgcgtgggcggcggttccaacgctatg
ggtcttttttccgagttcattccgcacaaggaagtgcggcttgtcggcgtggaacccgca
ggccggggactgggatacggggagcacgcggccacgttgtgtctgggcgaaccgggcgtc
atgcacggcttcaactcatacatgctcaaagacgaaacgggcgagcccgccgaagtctat
tccatctccgccgggctcgactaccccagcgtcggccccgaacacgctcacttgaaggac
ctgggccgcgccgaatacgtgcacgccagcgacaaggaagccctggacgctttcttcctg
ctctcacgcaccgaaggcatcatcccggccctggaatcatcccacgctctggcccacgcc
ctgcgcatcgcaccgacgctctccgcggacacgatcatcatcgtcaacctgtcgggacgc
ggcgacaaggatgtggatcagatcgagcgcatggttgaaagcggcgaaatcgtgcctccg
gtcctttag

DBGET integrated database retrieval system