KEGG   Desulfomicrobium baculatum: Dbac_1111Help
Entry
Dbac_1111         CDS       T00963                                 

Definition
aminoglycoside phosphotransferase
Orthology
K02204  
homoserine kinase type II [EC:2.7.1.39]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dbac_1111
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dbac_1111
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Dbac_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1222008..1222973)
Genome map
AA seq 321 aa AA seqDB search
MVNPPSPKPALHPSNELLRDILNCWGLTFEAIHPRISIQGSPERCLYRVVVDAGGSRHFL
EELDSRTLPRKRLIAARIAHLEAKALPVAAPQTGLDGSFTQRVGSRNWQLTPFLEGIELN
PEGSWRDAWRGKALALFLRDLRQASQNMAVHEDVFDLHGYVRKIVNDARRLHPNVCAELT
PVFSLIERKLESCASLPVAFCHGDPHPLNMIWGTDRILGAIDWEFCGPKCVLHDMALILG
CVGSEDENALSGPFITAFLKTLRGCGLLDSRLETHLPTWTLALRVAWLAEWLRRGDTEMT
QFEVFYMRTLENRFFGRDKAF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccccccttcccctaagcccgccctgcatccatctaacgaactactgcgcgac
attttgaactgctggggcctgactttcgaagccattcatccccgcatttccatccagggc
agccccgagcgctgcctgtacagagtggtagtggacgccggcggctcgcgccatttcctg
gaagaactcgattcccgaaccttgccacgcaaaaggctgatcgccgctcgcatcgctcat
ctggaagccaaggcattgcccgtggctgcgcctcagaccggacttgacgggagtttcacg
caacgtgtcggcagccggaactggcagctgacgccttttctggaggggattgaactcaac
ccagagggctcatggcgggatgcatggcgcggcaaggccctggctctgtttctgcgtgat
ctgcggcaggcgagccagaatatggccgtgcatgaagacgtctttgacctgcacggctat
gtccgaaaaatcgtgaatgacgccagaaggctgcatccgaacgtctgcgcggagcttacc
cccgtcttttctctcatcgagcgaaagcttgagtcctgcgccagtctgcctgtggctttc
tgtcacggcgatccccaccctctgaacatgatctggggcacggaccgcatcctgggcgcc
atcgactgggaattctgcggacccaaatgcgtcctgcacgacatggccctgatcctgggc
tgcgtaggcagcgaagacgaaaacgccctgagcggccccttcatcactgcctttctgaag
accctgcgcggctgcggcctgctggacagcaggctggaaacgcacctgccgacctggact
ctggccctgcgcgtggcctggttggcggaatggttgcggcgaggcgatacagagatgacc
cagttcgaggtcttctatatgaggaccctggaaaatcggttcttcgggcgagacaaggcg
ttctga

DBGET integrated database retrieval system