KEGG   Desulfomicrobium baculatum: Dbac_1111Help
Entry
Dbac_1111         CDS       T00963                                 

Definition
aminoglycoside phosphotransferase
Orthology
K02204  
homoserine kinase type II [EC:2.7.1.39]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dba01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dba00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1222008..1222973)
Genome map
AA seq 321 aa AA seqDB search
MVNPPSPKPALHPSNELLRDILNCWGLTFEAIHPRISIQGSPERCLYRVVVDAGGSRHFL
EELDSRTLPRKRLIAARIAHLEAKALPVAAPQTGLDGSFTQRVGSRNWQLTPFLEGIELN
PEGSWRDAWRGKALALFLRDLRQASQNMAVHEDVFDLHGYVRKIVNDARRLHPNVCAELT
PVFSLIERKLESCASLPVAFCHGDPHPLNMIWGTDRILGAIDWEFCGPKCVLHDMALILG
CVGSEDENALSGPFITAFLKTLRGCGLLDSRLETHLPTWTLALRVAWLAEWLRRGDTEMT
QFEVFYMRTLENRFFGRDKAF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccccccttcccctaagcccgccctgcatccatctaacgaactactgcgcgac
attttgaactgctggggcctgactttcgaagccattcatccccgcatttccatccagggc
agccccgagcgctgcctgtacagagtggtagtggacgccggcggctcgcgccatttcctg
gaagaactcgattcccgaaccttgccacgcaaaaggctgatcgccgctcgcatcgctcat
ctggaagccaaggcattgcccgtggctgcgcctcagaccggacttgacgggagtttcacg
caacgtgtcggcagccggaactggcagctgacgccttttctggaggggattgaactcaac
ccagagggctcatggcgggatgcatggcgcggcaaggccctggctctgtttctgcgtgat
ctgcggcaggcgagccagaatatggccgtgcatgaagacgtctttgacctgcacggctat
gtccgaaaaatcgtgaatgacgccagaaggctgcatccgaacgtctgcgcggagcttacc
cccgtcttttctctcatcgagcgaaagcttgagtcctgcgccagtctgcctgtggctttc
tgtcacggcgatccccaccctctgaacatgatctggggcacggaccgcatcctgggcgcc
atcgactgggaattctgcggacccaaatgcgtcctgcacgacatggccctgatcctgggc
tgcgtaggcagcgaagacgaaaacgccctgagcggccccttcatcactgcctttctgaag
accctgcgcggctgcggcctgctggacagcaggctggaaacgcacctgccgacctggact
ctggccctgcgcgtggcctggttggcggaatggttgcggcgaggcgatacagagatgacc
cagttcgaggtcttctatatgaggaccctggaaaatcggttcttcgggcgagacaaggcg
ttctga

DBGET integrated database retrieval system