KEGG   Desulfomicrobium baculatum: Dbac_1358Help
Entry
Dbac_1358         CDS       T00963                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
dba  Desulfomicrobium baculatum
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dbac_1358
Enzymes [BR:dba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Dbac_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1530488..1532881)
Genome map
AA seq 797 aa AA seqDB search
MQTKALSPELVAMMDAYWRAANYLSVGQIYLYDNPLLKKELMLKHIKPRLLGHWGTVPGL
NFIYVHLNRIIKAYDLNIINITGPGHGGPGLVANAYLEGTYSEVYPHISQDEEGLTRLFK
QFSFPGGIPSHVSPETPGSINEGGELGYALSHAFGAAFDNPDLLVACVIGDGEAETGPMA
TSWHSNKFLNPVHDGAVLPILHLNGYKIAGPTVLARIPHDELEALFHGYGYTPHFVEGDE
PMEMHVLMAATLDRVVGEIRRIQRDAREQGFTERPRWPMIILRTPKGWTCPREVDGKPTE
GTWRSHQVPMGDMGHPGHVKLLETWMKSYRPQELFDKSGRLRPELAGLAPAGERRMSANP
HANGGLFLRDLRLPDFGDYAVKVPKPGAVDAEATRVQGEFIRDVIARNPSTFRVFSPDET
SSNRWGAVFEVTSRCSMAAIVPGDEHVAPDGRVMEMLSEHQCEGWLEGYLLTGRHGFFSC
YEAFIHIVDSMFNQHAKWLDVTRGIPWRRPIASLNYLLSSHVWRQDHNGFSHQDPGFIDV
AANKKSEVIRVYLPPDANTLLCVTDQCLRSRNCVNVVVAGKQPGPQWLDMDAAVKHCAAG
IGIWPWASNDQGCEPDVVMACCGDVPTLETLAAVQLLREHFPALKIRVVNVVDLMKLQHH
REHPHGLSDGDFDTLFTTDKPVIFAYHGYPWLIHRLTYRRTNHGNLHVRGFKEEGSTTTP
FDMVVVNDLDRFRLMADVIDRVPQVGATAAYAKQAIRDKLIEHRQYIEEHGEDLPEIRNW
RWGLGEKEKLAGGKRES
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaaggccctctccccggaactcgttgcaatgatggacgcctactggcgcgcc
gccaactacctgtcggtcggccagatttatctttatgacaacccgctgctgaaaaaagag
ctcatgctgaagcacatcaagccgcgcctgctcggtcactggggcacggtgccgggcctg
aacttcatctatgtgcatttgaaccgcatcatcaaggcgtacgatctgaacatcatcaat
atcaccgggccgggccatggcgggcccgggcttgttgccaacgcgtatctcgaagggacc
tacagcgaggtctatccccacatttcgcaggacgaggagggcctgacgcggctcttcaag
cagttctccttccccggcggcatcccgagccacgtctcgccggagacgccgggctcgatc
aacgagggcggagagctgggctatgcgctgtcgcatgctttcggagcggccttcgacaac
ccggacctccttgtcgcctgcgtcatcggcgatggcgaagcggagaccggccccatggcc
acgagctggcactcgaacaagttcctgaatccggtccatgacggcgccgtgctgccgatc
ctgcacctgaacggctacaagatcgccggtcccaccgtgctcgcgcgtattccccatgac
gaactggaggcgctcttccatggctacggctacaccccccatttcgtcgagggtgacgag
cccatggagatgcacgtcctcatggccgccactcttgaccgcgtggtgggcgagatccgg
cgcatccagcgggacgcccgcgaacaggggttcacggagcggccgcgctggccgatgatc
atcctgcgcacgcccaagggctggacctgcccgcgggaagtggatggaaaacccacggaa
ggcacctggcggtcgcatcaggtgcccatgggcgacatgggccatccaggccatgtgaag
cttttggagacgtggatgaagagctaccggccgcaggagctgttcgacaagtccggccgg
ctccgccccgagctggccgggctcgcgccggcaggggagcgccggatgagcgccaacccc
cacgccaacggcggcctgttcctgcgcgacctgcgcctgccggatttcggcgactacgcg
gtcaaggtcccgaaacccggcgcggtggacgccgaggccacccgcgtgcagggcgagttc
atccgcgacgtgattgcacgcaacccatccaccttccgcgtcttcagcccggacgagacg
agctcgaaccgctggggcgcggtgttcgaggtcaccagccgctgctcgatggcggccatc
gtccccggcgacgagcacgtcgcgcccgatggccgggtcatggagatgctgagcgagcac
cagtgcgagggctggctcgaagggtatctcctgaccggccgccacggcttcttttcctgc
tatgaagcgttcatccacatcgtggattcgatgttcaaccagcacgccaagtggctggac
gtcacgcgcgggattccctggcgccgccccatcgcctccctcaactacctgctctcgtca
catgtctggcggcaggaccacaatggcttcagccatcaggacccaggcttcatcgatgtc
gcagccaacaagaagtccgaggtcatccgcgtctatctcccgcccgatgcgaacaccctg
ctctgcgtgacggatcaatgcctgcgcagccgcaactgcgtgaacgtggtcgtggccgga
aagcagcccgggccgcagtggctggacatggacgccgccgtcaagcactgcgccgccggc
atcggcatctggccgtgggccagcaatgaccagggctgcgagccggatgtcgtcatggcc
tgctgcggcgacgtgcccaccctcgaaaccctggcggcagtgcagctcctgcgcgaacat
ttcccggccttgaaaatccgggtggtgaacgtggtcgatctcatgaagctgcagcatcac
cgcgagcacccacacggcttgagcgacggcgatttcgacacgctgttcactaccgacaag
ccggtcatctttgcctaccacggctacccgtggctgatccaccggctgacctaccgtcgc
accaaccatgggaaccttcacgtgcgcggcttcaaggaggaagggtcgaccacgacgccg
ttcgacatggtggtcgtgaacgacctcgaccgctttcgcctcatggccgacgtcatcgat
cgcgtgccgcaggtcggcgccacggccgcgtatgccaagcaggccatccgcgacaaactc
atcgagcaccggcagtacatcgaggagcacggcgaagatctgccggagattcggaactgg
cgatgggggctgggcgaaaaggaaaaactggcgggcggaaaacgcgagtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system