KEGG   Desulfomicrobium baculatum: Dbac_1410Help
Entry
Dbac_1410         CDS       T00963                                 

Definition
MCP methyltransferase/methylesterase CheR/CheB with PAS/PAC sensor (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dba  Desulfomicrobium baculatum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581682..1585044
Genome map
AA seq 1120 aa AA seqDB search
MTKKYSPKQKKPASAASNTQTSIKPSLYVAVGASAGGLEAIEAFFSGMAPDSGMAFIVIQ
HLSPDYKSLMVEILSKKTKMKVLRAEEGMPVLPDNVYLIPPKKNLSIFHGKLLLNDQEHV
KGTINLPIDIFLRSLAEDQGDKAVAVILSGSGSDGMRGVRAIKEFGGMVMVQSESTAKFD
SMPRASLSTGLVDFILPPEEMPERLLSYAKHPFVIKAERSETVISDEDALTRIFAILRDK
FKADFTYYKPSTVTRRIERRMSINRIDEIRDYVAYMQNFPGEAGTLFREFLIGVTRFFRD
REVFELLKESWLPEILNRSAGKESRFWIAGCSTGEEAYTLAILAKEYMLQSGINRDLKIF
ATDIDRDAVLFAANGVYPDSIAADVPQELLSKYFYRKQDSYQISRNIREMVVFAQHNLIK
DPPFTNIDLISCRNLLIYLQPVLQRKVLEFFNFSLNAQGVLLLGTSETIGEMGDCFESLD
HKSKIYRTKGRFKHSLDSHELPQVPGSTYRDLGSRFPVMRRDPHVNDERILERFLEALSA
DNFPLAVVVNEQMEVLHVFGDTTGYFKLPSGKLSRDISKMAAKDLSIPLSTGIQKVFRKQ
EALRFSNIKLRDMDALKVVDLRILPLPQKKGQEPLVAVFLEEVARPDILDKTQAIQAYDL
SLEAEQRITDLEQELQFTRENLQATVEELETANEELQATNEELLASNEELQSTNEELQST
NEELYSVNSEYQSKIVELSELHNDVDNLLNVSQIGQLLLDENMDIRRFSPKIAEVFNVLG
ADVGRSLSDISHQLENADPVRIIESVHRQGKLAEHEVRAKDGRWYLMRVVPYSVGPRVFS
GTLVSFVDITRMKLGEEALRASEEEYRALFETLPLGVVYHEADGSIISANPAAGRILGLT
LDQILGKTSMDPRWNMIREDGSTVAGTHHPAMIALRTGHKEGPVVRGVFHPEKNAHIWLS
ITAMPLFKPGESTPSQVYATFEDITEKRQAEQDFQTLFREMFNGFSLHEIICDEKGTPVD
YRFLAVNPAFERMTGLKAEQVLGKTVLEIMPDTEKFWIEAFGEVALTGKSSKFEQYSSQV
GKRFQVTAFRPARNQFACIFAEVMDGEGVDNAVQPTAQAS
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagtattcccccaaacaaaagaagccggcatccgccgcatccaacacgcag
acgtcgatcaaaccgtccctgtatgtggcggtgggagcttcggccggaggcctggaagcc
attgaagcttttttctcgggcatggccccggacagcggcatggccttcatcgtcatccag
cacctgtctccggactacaagagccttatggtcgagatcctttccaagaagaccaagatg
aaagtgctccgggccgaggagggcatgccggtcctgccggacaacgtctatctgattccg
cccaagaagaacctgagcatatttcacggcaagctgctcttgaacgaccaggaacacgtc
aaaggcaccatcaacctccccatcgatatttttttgcgttccctggccgaagaccagggc
gacaaggccgttgccgtcatcctttctggatcgggcagcgacggcatgcgcggcgtgcgg
gccatcaaggagttcggcggcatggtcatggtccagagcgaaagcacggccaaattcgac
agcatgccccgggcctccctttccacgggactggtggacttcatcctgccgccggaggaa
atgcccgaacgattgctttcctacgccaagcaccccttcgtcataaaagccgagcgctcc
gagaccgtcatcagcgacgaggacgccctgacccgcattttcgccatcctgcgcgacaag
ttcaaggccgatttcacctactacaagcccagcaccgtgacccggcgcatcgaacgccgc
atgtccataaaccgcatcgatgagatccgggattatgtggcctacatgcagaattttccc
ggcgaggcgggcacgttgtttcgcgaattcctgatcggcgtgaccagattcttccgcgac
cgggaggtgtttgaacttttgaaggaaagctggctaccggaaatcctgaaccgctccgcc
ggaaaagagagccggttctggatcgccggttgctccacgggagaggaggcctacaccctg
gccatcctggccaaggaatacatgcttcagtccggaatcaaccgtgacctgaaaattttc
gccacggacatcgaccgcgacgccgtccttttcgcggccaacggggtctaccccgacagc
atcgccgccgacgtcccgcaggagctgctgagcaagtatttctaccgcaagcaggacagc
tatcagatttcccgcaacatccgcgagatggtcgtctttgcccagcacaacctcataaaa
gaccctccgttcaccaatatcgatcttatctcctgccgcaacctgcttatctacctgcag
cctgtcctgcagcgcaaagttttggagtttttcaatttttcgctcaatgcccagggcgtt
ttgctgctcggcaccagcgaaaccatcggcgagatgggcgactgtttcgagagcctcgat
cacaaaagcaagatttaccgcaccaaggggcggttcaagcacagcctcgattctcatgag
ctgccccaggttccgggttcgacctaccgcgacctgggcagccgtttcccggtgatgcgc
cgggatccgcacgtcaatgacgagcgcattctggagcgtttcctggaagcgctaagcgcg
gacaatttccccctggccgtggtcgtcaacgagcagatggaggtgctgcacgtcttcgga
gacaccacagggtatttcaagctgccctcgggcaagctctcgcgggacatctccaagatg
gcggccaaggatctgtccatccctctttccaccggcatccagaaagttttccgcaagcag
gaggcgcttcgcttctccaacatcaagctgcgcgacatggatgcgctcaaagtggtggat
ttgcggattctgcccctgccccagaaaaaagggcaggagccgctggtggccgtatttctg
gaagaggtcgcacggcccgacattctggacaagacacaggccattcaggcttatgatctg
tccctggaagccgagcagcgcatcaccgacctggagcaggagctgcaattcacccgcgag
aacctgcaggcaacggtagaggaactggagaccgccaacgaggaattgcaggccaccaac
gaagagctccttgccagcaatgaggagttgcaatccaccaacgaggaactgcaatccacc
aatgaagagctgtattcggtcaattccgagtaccagtccaagatcgtggagctgagcgag
ctgcacaacgacgtggacaacctcttgaacgtcagccagatcgggcagctcctgctcgac
gagaacatggatatcaggcgtttttcacccaaaatcgccgaggtgttcaatgtgcttggc
gcggatgtggggcggagcttgtcggacatctcccaccagctcgaaaatgccgatccggtc
cggatcatcgagagcgtgcacaggcaagggaaattggcagagcacgaggtccgcgccaag
gatggccgctggtatctgatgcgagtggtgccgtattccgtagggccgagggtcttttcc
ggcaccctggtttcctttgtggacatcacccgcatgaagctcggcgaggaggctctgcgt
gcaagcgaggaagaataccgcgccctctttgaaaccctccccttaggcgtggtctaccat
gaggccgacggctccatcatctccgccaacccagctgcgggacgcattctggggcttacc
ctggaccagatactgggcaagacatccatggacccgcgctggaatatgatccgcgaggat
ggctccactgtggccggaacgcaccacccggccatgatcgccttgcggaccggacacaag
gagggaccggtggtgagaggggtctttcatcccgagaagaacgcgcacatctggctctcc
atcaccgccatgcctctgttcaaacccggcgagagcacgccttcgcaggtctatgcgaca
tttgaggacataactgaaaaacgccaggcggagcaggactttcagacgctttttcgggaa
atgttcaacggattctcgttgcatgagatcatctgcgacgaaaaaggcacgcccgtggat
taccgttttctggccgtcaatcccgctttcgagaggatgactggcctgaaagccgagcag
gttttgggcaagaccgttcttgaaatcatgccggatacggaaaaattctggatcgaggct
ttcggcgaggtggccctgaccggtaagtcctcgaaattcgaacaatattcgtcgcaggtc
ggcaaacgttttcaagtcacggctttcaggccggcgcgtaatcagtttgcctgtattttt
gccgaggtcatggatggtgaaggggtcgataatgcggttcaacccaccgcccaggcctct
tga

DBGET integrated database retrieval system