KEGG   Desulfomicrobium baculatum: Dbac_1434Help
Entry
Dbac_1434         CDS       T00963                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dba00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1622795..1624306)
Genome map
AA seq 503 aa AA seqDB search
MARYVGAVDQGTTSSRFIIFDEHGRIVGMDQKEHEQIYPKPGWVEHDPMEIWNNTQDVIR
GALAKSGIRGSDLSSIGITNQRETTVVWDRFTGKPYYNAIVWQCTRTHEICKQLMADGGQ
DRFRLVTGLPVATYFSGPKMRWILDNVPEARAAADKGNALFGTIETWIIWWLTGGPKGGA
HVTDVTNASRTMLMDLKTLSWDEEILKIMDIPLQGLPRIVPSSDSETWGPTSEDGPIGAR
VPVCGAVGDQQAALVGQTCFAPGEAKNTYGTGCFLLMHTGHEPIQSKHGLITTLAYQFSG
RKPSYCLEGSIAIAGALVQWLRDNLQMFSSAPEIETLARKVEDTGGMYIVPAFSGLYAPY
WRPDARGVMVGLTRYINRNHFARAVLEATAYQTKDIVLAMNKDSGVDLKTLKADGGMVFN
ELLMQFQADILNVPVVRPKVAETTCLGAAYAAGIASGFWSGREELYNNWEEDKRWVPDME
EEKRRELFAGWQKAVTRTFDWVE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctacgtaggagcagtcgatcagggaaccaccagcagccgtttcatcattttc
gacgagcacggccgcatcgtcggcatggatcaaaaagagcatgagcagatttatccgaaa
cccggctgggtcgaacacgatcccatggagatctggaacaacacccaggacgtcatccgg
ggagcgctggccaagtccgggatcagaggctccgatctctcgtccatcggcatcaccaac
cagcgcgagaccaccgtggtctgggaccgcttcacgggcaagccctactacaacgccatt
gtctggcaatgcacccgcactcacgaaatctgcaagcagctcatggccgacggcggtcag
gaccgtttccgcctcgtgaccggactgcccgtggcaacctatttttccggacccaagatg
cgctggattctggacaacgtgcccgaggcccgcgcggccgcagataaaggcaacgccctc
ttcggcaccatcgagacctggatcatctggtggctgaccggcggtcccaaaggcggcgcg
catgtgaccgacgtgaccaacgccagccggaccatgctcatggacctcaaaacgctgagc
tgggacgaagaaatcctgaagatcatggacattccgctgcagggtctgccgcgcattgtg
ccctcctccgacagcgagacctggggtcccaccagcgaggacggccccatcggcgcgcgc
gtgccggtctgcggagccgtgggcgaccagcaggccgcccttgtggggcagacctgcttc
gcgcccggcgaagccaagaacacctacggcacgggttgcttcctgctcatgcacacgggt
cacgagcccatccagtcaaaacacggactgatcaccacgctggcctatcagttcagcggc
cgcaagccgtcctactgtcttgaaggctccatcgccattgccggggccctggtgcagtgg
ctcagggacaacctgcagatgttctcgtcggccccggagatagagactctggcccggaaa
gttgaggatacgggcggcatgtacattgtcccggccttttccggtctttacgccccctac
tggcggcccgacgcgcgcggcgtcatggtcggcctgacccgctacatcaaccgcaaccat
ttcgcccgggccgtgcttgaggccacagcctaccagaccaaggacatcgtcctggccatg
aacaaggactccggcgtggacctgaaaaccctcaaggccgatggcggcatggtcttcaac
gaactgctcatgcagttccaggcggacatcctgaacgtacccgtggtccggcccaaggtg
gccgaaaccacctgcctgggcgcggcctacgccgcaggcatcgcctcgggcttctggtcc
ggtcgcgaggagctctacaacaactgggaagaggacaaacgctgggttccggatatggag
gaagagaaacgcagggagttgttcgcaggttggcaaaaggccgtaaccaggacttttgat
tgggtcgaatga

DBGET integrated database retrieval system