KEGG   Desulfomicrobium baculatum: Dbac_1508Help
Entry
Dbac_1508         CDS       T00963                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dba  Desulfomicrobium baculatum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dbac_1508
   00052 Galactose metabolism
    Dbac_1508
   00500 Starch and sucrose metabolism
    Dbac_1508
   00520 Amino sugar and nucleotide sugar metabolism
    Dbac_1508
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dbac_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702933..1704381
Genome map
AA seq 482 aa AA seqDB search
MAQDISCVSVDDPKLSTLFRPFALKMEQQGLPPIVINTFKCYFNQFLYGAQVKLSDRDVM
AVHDDELADYDAMEQFKDKGEKALGKTAVIKLNGGLGTSMGLESAKSLIPVKEGLSFLDL
ILLQASTVRTHYGVDFPQVFMNSFKTHMDTMLKVGDFHNGTTGIDLAFLQHRYPKIMAKD
HSPASWPRNPELEWNPPGHGDIYTAMITSGILDALLDKGYLYAFISNSDNLGAIMNRRLL
GYMVHHNLPFLMEVARRTEQDKKGGHLCRLKKNKQLALREVAQCPDNEMESFCDIEKYKF
FNTNSIWIDLRILQSVFISHRMMPLDLIINPKSLDPRDPSSPKVFQLETAMGSAITNFLN
AQAVIVPRKRFAPVKTTNDLLLVMSDCFVRTERETIIPNPDRSTPMPSISLDENYFKKID
AFLARFPKNPPSLLKCDSLVIEGDVRFEEDVRCVGDVRLVNRGPKQEVIKAGSVLQGETV
FA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggatatcagttgcgtcagcgtcgacgaccccaaactctccactctcttcagg
ccctttgccctgaagatggagcagcaaggactgccgcccatcgtcatcaacaccttcaag
tgttactttaaccaattcctgtacggcgcccaggtcaagctttccgaccgcgacgtcatg
gccgtgcatgacgacgaactggcagattacgatgccatggagcagttcaaggacaagggt
gaaaaagcgctgggaaagaccgcggtcattaagctcaatgggggccttggcaccagcatg
ggcctggagtcggccaagtcgcttattccggtcaaggaggggctcagctttctggacctc
atcctgctgcaggcctcgacggtccgtacccactacggggtggattttccgcaagtcttc
atgaacagcttcaagacgcacatggacaccatgctcaaagtcggggactttcataacggc
acgaccggcatcgacctcgcttttctgcagcatcgctaccccaagatcatggccaaagac
cacagccccgcgtcctggccccggaatccggagctggaatggaatcctccgggacacgga
gacatctacaccgccatgatcacctcgggcatcctcgatgccctgctggacaaaggctac
ctgtacgctttcatttccaactccgacaatctcggagccatcatgaatcgccgcctgctc
ggctacatggtccaccacaacctgccttttttgatggaagtcgcccgtcgcacggaacag
gacaaaaaaggcgggcatctctgccgcctgaaaaagaacaagcagctcgctctgcgcgaa
gtggcccagtgtcccgacaacgagatggaatcgttctgcgacatcgaaaaatacaaattc
ttcaacaccaattccatctggatagacctgcgcatcctgcagtctgttttcatctcgcat
cgcatgatgccgcttgacctgatcataaaccccaaaagcctggatcctcgcgatccgtcc
tcgccaaaagtttttcaactggaaacggcaatgggttcggccatcaccaatttccttaat
gcccaggccgtcatcgtgccccgaaaacgctttgccccggtcaaaacgacaaatgacctg
ctccttgtcatgtccgactgctttgtacgcacggagcgcgagaccatcatccccaacccg
gatcgcagcacacccatgccgtccatctctttggacgaaaactatttcaagaaaatagac
gcgttcctggcccgtttccccaaaaacccgccgtccctgctcaaatgcgacagcctcgtg
atcgaaggagatgtccgcttcgaggaagacgttcgttgcgtgggcgatgtacgcctcgtc
aacagagggccgaagcaggaagtgatcaaagccggctccgtactgcagggagagaccgtc
tttgcgtga

DBGET integrated database retrieval system