KEGG   Desulfomicrobium baculatum: Dbac_1539Help
Entry
Dbac_1539         CDS       T00963                                 

Definition
(RefSeq) caa(3)-type oxidase subunit IV
  KO
K02277  
cytochrome c oxidase subunit IV [EC:1.9.3.1]
Organism
dba  Desulfomicrobium baculatum
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Dbac_1539
Enzymes [BR:dba01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Dbac_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1743450..1743746)
Genome map
AA seq 98 aa AA seqDB search
MTTHTHIMPFALLTKIWLALMVLTGITVGVTSFDFGYLNVLVAMAVASAKALLVIFFFMH
LKYENRILGVFLLLVFVILAIFIGFTFFDVAMRPETTP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacatactcacatcatgcccttcgctctcctgaccaagatctggctggccctg
atggtcctgaccggcatcacggtgggggtgacgagcttcgacttcggatacctgaacgtg
ctggtggccatggccgtggcctcggccaaggcgctgctggttatcttcttcttcatgcac
ctcaaatacgaaaatcgcatcctcggggtctttctgctgctggttttcgtcatcctggcc
atcttcatcggcttcacctttttcgacgtggcgatgcggccggagacgaccccatga

DBGET integrated database retrieval system