KEGG   Desulfomicrobium baculatum: Dbac_1539Help
Entry
Dbac_1539         CDS       T00963                                 

Definition
caa(3)-type oxidase subunit IV
Organism
dba  Desulfomicrobium baculatum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1743450..1743746)
Genome map
AA seq 98 aa AA seqDB search
MTTHTHIMPFALLTKIWLALMVLTGITVGVTSFDFGYLNVLVAMAVASAKALLVIFFFMH
LKYENRILGVFLLLVFVILAIFIGFTFFDVAMRPETTP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacatactcacatcatgcccttcgctctcctgaccaagatctggctggccctg
atggtcctgaccggcatcacggtgggggtgacgagcttcgacttcggatacctgaacgtg
ctggtggccatggccgtggcctcggccaaggcgctgctggttatcttcttcttcatgcac
ctcaaatacgaaaatcgcatcctcggggtctttctgctgctggttttcgtcatcctggcc
atcttcatcggcttcacctttttcgacgtggcgatgcggccggagacgaccccatga

DBGET integrated database retrieval system