KEGG   Desulfomicrobium baculatum: Dbac_1587Help
Entry
Dbac_1587         CDS       T00963                                 

Definition
formate C-acetyltransferase (EC:2.3.1.54)
Orthology
K00656  
formate C-acetyltransferase [EC:2.3.1.54]
Organism
dba  Desulfomicrobium baculatum
Pathway
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dbac_1587
   00640 Propanoate metabolism
    Dbac_1587
   00650 Butanoate metabolism
    Dbac_1587
Enzymes [BR:dba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Dbac_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1801155..1803647)
Genome map
AA seq 830 aa AA seqDB search
MTRFTCGCMSPQEERLYNQIEGKEDKFRKTHSRVFKLLEKFDGQKPRIDIERALFFTQSM
QQTEGQPLVLQWAKAMKHIAENMTVYVQEDQLLLGRAGCDGRYGILYPELDGDFLDIAVK
ELPNRPTSPATITPEDAKIVVEEIAPFWKGKTFHEKLNAALPEEVHKLTYDDPSGLMSRF
IVNETASFRSSIQWVHDYEKVLKRGFNDIKREALEKLADLDPLSPKDNCEKKPFLEAVVI
VCDAIVLWAKRHAVLAREVAEKETNPERKAELIRMAENAERVPGEPARNFWEACQSQWFM
QMFSRIEQKTGTTISNGRMDQYFLPYYAQDIDAGTLTEEKAMELLECMWVGMAEFIDMYI
SPTGGAFNEGYAHWEAVTVGGQTPEGRDATNDLTHLILKSKREFPLHYPDLAARIHSRSP
ESYLWDVAETIKDGSGFPKLINDEEIVPLYVSKGATFAEAYDYAVSGCTEARMPNRDTYT
SGGAYINFAAAVEMVLRNGRMKKYGDIDLGVKTGDPTAFSTWDEFWDAYVQQHLLFLRAA
FVQQYTINKIRATCFAQPMGSAVHDLCMKHCIDLHQEQIPEGINLGYFEYMGLGTVVDSL
AAIKKLVFEDKKLTMQQIIDAVDANFEGFEDVEALLRSAPCYGNNDPYADSIGREIDRIS
VEYGGKYSKELGMHNDVRYVPFTSHVPFGKVVSATPNGRKQFTPLSDGSSASHGADVNGP
TAILLSNYNTKNYGMRDRAARMLNIKFTPKCIEGEQGTEKLVSFIRTFCDLKIWHVQFNV
INRDTLIAAKKDPQKYRNLIVRIAGYSAYFVDLSPDLQDDLIARTEHGAL
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctttacatgtggctgcatgtcacctcaggaagaacgtctttacaatcagatc
gaaggcaaagaagataaattcagaaagacgcatagccgcgttttcaagcttttggaaaaa
tttgatggacagaagccgcgtatcgatatcgaacgcgccttgttcttcacacagtcaatg
cagcagacggaaggtcagccgttggttctgcaatgggcaaaggccatgaagcacattgcc
gagaacatgaccgtttacgttcaggaagatcaacttctgctgggccgcgccggttgtgac
ggacgttacggcattctctatcccgagctcgatggcgatttcctcgacatcgctgtgaag
gagctgcctaaccgcccgacctctcctgcgaccatcacccccgaggacgccaagatagtg
gtggaagagatcgcccctttttggaagggcaagacctttcacgaaaagctcaacgccgct
ctgcccgaggaagtgcacaagctgacctatgacgatccgtccggtctcatgtcccgcttc
atcgtcaacgagactgcgtccttccgctcttccatccagtgggtccatgactacgaaaag
gttttgaagcgcgggttcaacgacatcaagcgcgaagccctggaaaagctggccgatctc
gatccgctcagccccaaggacaactgcgagaagaagcccttcctcgaagccgtagtcatc
gtctgcgacgccatcgtgctctgggccaagcgtcacgccgtgctggcgcgtgaagtggcg
gaaaaggaaaccaatcccgaacgcaaggcggaactcatccgcatggccgaaaacgccgaa
cgcgtacccggcgagcccgcccgcaacttctgggaagcctgccagagccagtggttcatg
cagatgttctcccgcatcgaacagaagacaggcacaaccatctccaacggacgcatggat
cagtatttcctgccgtattacgcccaggacatcgatgccggcacgctgaccgaagagaag
gccatggaactcttggagtgcatgtgggtcggcatggccgaattcatcgatatgtacatc
tcccccacgggcggggccttcaacgaaggctacgcacactgggaagctgtaacggttggc
ggccagactccggagggacgcgacgccaccaacgacctgactcacctcatcctcaagtcc
aagcgcgaatttccgctgcactacccggacctcgccgcccgcatccacagccgttcgccc
gagagctatctgtgggacgtggccgagaccatcaaggacggctcgggcttccccaagctg
atcaacgacgaggagatcgtgcccctctatgtctccaagggcgcgaccttcgccgaagcc
tatgactacgccgtgtccggctgcaccgaggcacgcatgcccaaccgtgacacgtacacc
tccggtggcgcgtacatcaacttcgccgcggccgtggaaatggtgctgcgcaacggacgt
atgaagaagtacggcgacatcgacctgggcgtgaagaccggcgatccgaccgcgttctcc
acctgggacgagttctgggacgcctatgtgcagcagcaccttctgttcctgcgcgccgcc
ttcgtgcagcagtacaccatcaacaagatccgcgcgacctgcttcgcccagcccatgggt
tccgccgtgcatgacctgtgcatgaagcattgcatcgacctgcatcaggagcagatcccc
gagggcatcaaccttggctacttcgagtacatgggtctgggaacagtcgtggactccctg
gcggccatcaagaagcttgtctttgaagacaagaagctgaccatgcaacagatcatcgac
gcagttgacgccaacttcgaaggtttcgaggatgtcgaggcgctgctgcgctccgccccc
tgctacggcaacaacgatccctacgccgacagcatcggtcgtgaaatcgacaggatttcc
gtggaatacggcggcaagtacagcaaggaactgggcatgcacaatgacgtgcgctacgtg
cctttcacctcgcatgtgcctttcggcaaggtcgtcagcgccacccccaacggacgcaag
cagttcaccccgctgtccgacggttcctcggcctcccacggcgcggatgtcaacggcccc
acggccatcctgctgtccaactacaataccaagaactacggtatgcgcgaccgcgcggcc
cgcatgctcaacatcaagttcacgcccaagtgcatcgagggcgagcagggcacggaaaag
ctcgtctccttcatccgcactttctgcgacctgaagatctggcacgtgcagttcaacgtc
atcaaccgcgacacgctcatcgcggccaagaaggatccgcagaagtaccgcaatctcatc
gtgcgcatcgctggctacagcgcctacttcgtggatctgtccccggacctccaggacgac
ctcatcgcccgcacggagcatggcgctctttaa

DBGET integrated database retrieval system