KEGG   Desulfomicrobium baculatum: Dbac_1609Help
Entry
Dbac_1609         CDS       T00963                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dba  Desulfomicrobium baculatum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dba00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1823834..1824709
Genome map
AA seq 291 aa AA seqDB search
MHHEFFDLGPRRGRNIYVLPVPYEGTVSYGTGTRLGPEALFRASVQIESFDAELDLDLAD
LAHFTPLPVVHPPASGPDGLHQAMREHLKGLDATKDFVLTLGGEHSVPLPLFEFYRQAHP
DLALLHIDAHADLRESYEDSPYSHACIMARARQLGIPLAQIGIRSLCREQRDYMRAQNPS
ELMTLFAWDLPTPGEAAERIRAFIGGRPLYISFDVDGMDPSVIPGTGTPEPGGIPYRWMT
RFCKELWLDGLGPKLVGMDMCELAPIHGSQASETAAVKLIQRILTAWLGLA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcatcacgaattttttgacctcgggccacggcggggacgtaatatttacgtactgccc
gtcccatacgaaggcacggtcagctacggcacgggcacgcgcctgggcccggaggcgctg
ttccgggccagcgtgcagattgaatcctttgacgcggaactggaccttgatctggccgat
ctggcccactttaccccgctccccgtggtccatcccccggccagcggtcccgatggtctg
caccaggccatgcgcgaacacctcaagggactcgacgcgaccaaggacttcgtcctgaca
ctgggcggcgagcactcggtgcccttaccccttttcgaattctaccggcaggcccatccc
gacctggccctgctgcacatcgatgcccatgcggacctgcgcgaaagctacgaggacagc
ccgtattcccacgcctgcatcatggcccgggcccggcagctgggcatccccctggcccag
atcggcatccgctccctttgccgggagcaacgggactacatgcgcgcgcagaacccctcg
gaactcatgaccctcttcgcctgggacctgcccactcctggcgaggcggcagaacgcatc
cgggcctttatcgggggcaggcccctgtatatctctttcgacgtggacggcatggacccc
agcgtcatccccggcacgggcacacccgaacccggcggcatcccctacaggtggatgacc
cgcttctgcaaagagctgtggctcgacggactgggcccgaagctggtcggcatggacatg
tgcgaactcgcgcccattcacggctcccaggcatcggagaccgccgccgtcaagctcatc
cagcgcatcctgaccgcctggctcggactcgcctga

DBGET integrated database retrieval system