KEGG   Desulfomicrobium baculatum: Dbac_1673Help
Entry
Dbac_1673         CDS       T00963                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dba  Desulfomicrobium baculatum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dbac_1673
Enzymes [BR:dba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dbac_1673
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dbac_1673
Lipid biosynthesis proteins [BR:dba01004]
 Fatty acid synthase
  Component type
   Dbac_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1908008..1908658
Genome map
AA seq 216 aa AA seqDB search
MSSILIWSITWAAALILLCPVRGACAGPEIHILAFGDSLTAGYNLPPSKSFAAQLEERVL
SQGRKVRVTNAGLSGDTTSGGRTRLAWSLQDKPDLIILELGANDGLRGLDPVFMRENLDA
MIQECLDTGARVILAGMRAPVNWGEAYRTEFEKVFPELAQKYGLPLYPFFLEGVITNPAL
LLEDGLHPNAGGVERIVDGILPLVLDEVDGLMQSPA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgatccttatatggagtatcacctgggccgcggccctcatattgttatgtccg
gtccgcggagcgtgcgcggggcccgagatacacatcctcgccttcggggacagcctgacc
gccggctacaacctgcctccctccaagtccttcgccgcccaactggaggagcgggtgctg
agccagggacgaaaagtccgggtcaccaacgcgggtctgtccggcgacaccaccagcggc
gggcggacacgcctggcctggtccctgcaggacaagccggacctgatcatccttgaactc
ggcgccaatgacggcctgcgcgggctggatccggtcttcatgcgcgagaacctcgacgcc
atgattcaggaatgccttgacaccggagcccgagtaatactggccggaatgcgcgctccg
gtcaattggggagaagcttatcgaacggagttcgaaaaagttttccccgagctggctcaa
aaatacgggctgcctctgtaccctttttttttggaaggggttataacaaatccggcccta
cttcttgaagacggactgcatcccaatgctggtggcgtggagcgcatcgtggacggtatc
ctgcccctggtcctggacgaagtggacggcctgatgcaaagtcccgcataa

DBGET integrated database retrieval system