KEGG   Desulfomicrobium baculatum: Dbac_2049Help
Entry
Dbac_2049         CDS       T00963                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dba  Desulfomicrobium baculatum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dbac_2049
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dbac_2049
Enzymes [BR:dba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Dbac_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2355905..2357134
Genome map
AA seq 409 aa AA seqDB search
MLSTVLELLKNSREELLRLQTDLVAIPALGPTNAGQGEKAKVEYLAEYASRFAGVRTEMI
KAPDDRVECGYRPSLIVRRPGKSPRTLWLIAHTDVVPTGDLSLWESDPFVLRQEGDLIYG
RGVEDNHQGMVSALLLLRALETVAARTDLSLGILLAADEETGNTYGIEYIMTHHPQVFAP
NDLIVIPDFGTPAGDAIEVAEKSVLWLRFTVQGRQCHASTPEAGVNSLVGASALILALDR
LHTVFDACDPLFDPPMSTFAPTKMEANVPNVNTIPGQDVFHLDCRVLPSYPLEEIEQEIR
LICDKVEAERGVRIAFAPVVREQAAPATPADCEAAERLTAVLEKTRGLAARAIGIGGGTV
AAAFRKRGLPAVCWSTLMHTAHQPNEHASVTATLADARVFAHLLFEDQA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcactgtacttgaactcctgaaaaacagccgcgaggaattgctgcgactgcag
acggaccttgtggccatccccgccctcgggccgaccaacgcgggtcagggcgaaaaggcc
aaggtggaatacctggccgagtatgcgagccgattcgcaggcgtccggacggaaatgatc
aaagctccggacgacagggtcgagtgcggctaccggcccagcctgatcgtcaggcggccg
ggaaaaagcccgcgcacgctgtggctcatcgcccacaccgacgtcgtgcccaccggcgac
ctgtccctgtgggaaagcgatccgttcgtgctgcgccaggagggcgacctcatctatggg
cggggcgtggaagacaaccaccagggcatggtcagcgcgctgctcctgctgcgcgccctg
gaaacggtcgcagcgcggactgacctctcgttaggcatcctgctcgcggccgacgaagag
acgggcaacacgtacggcatcgaatacatcatgacccatcacccgcaggtcttcgcgcca
aatgacctcatcgtcatcccggacttcggtactccggcaggggatgccatcgaggtcgct
gaaaaaagcgtgctctggctcagattcacggtacagggcaggcaatgccacgcctcgacc
ccggaggccggagtcaattccctggtcggcgcttcggcgctgattctggccctggacagg
ctgcacacggtcttcgacgcgtgcgatccgcttttcgatccgcccatgtccacctttgcg
ccgaccaagatggaagccaacgtccccaacgtgaacaccatcccgggccaggacgtcttt
catctcgactgccgcgtgctgccctcgtacccgctggaagagatcgagcaggagatacgc
ctcatctgcgacaaggtggaggccgaacggggcgtgcgcatcgcctttgcgcccgtggtc
agggagcaggccgccccggctactcctgcagattgcgaggccgcagaacgactgaccgcc
gtccttgaaaaaacacgcgggcttgcggcacgcgcaatcggcatcggcggcggcacggtg
gcggccgcgttccgcaagcgaggacttcccgccgtgtgctggtccaccctcatgcatacg
gcgcaccagcccaacgaacacgcgtccgtgacggccaccctcgccgacgcacgggtgttt
gcccatctcctcttcgaagaccaggcataa

DBGET integrated database retrieval system