KEGG   Desulfomicrobium baculatum: Dbac_2068Help
Entry
Dbac_2068         CDS       T00963                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dba  Desulfomicrobium baculatum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dbac_2068
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dbac_2068
   00630 Glyoxylate and dicarboxylate metabolism
    Dbac_2068
Enzymes [BR:dba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dbac_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2372527..2374680
Genome map
AA seq 717 aa AA seqDB search
MTYIPVGGLNVAKPLHDLIRDKATPGTGVTDTDFWAAFEKILHDLSPRNRELLAKRQYLQ
ETIDSWHKRHKDGPHDAVAYEQLLREIGYIVPEGLPFSIGTSGVDPEISSIAGPQLVVPA
TNARYALNAANARWGSLYDALYGTDVLSEEGGATREGAYNPVRGTKVMEFAARFLDKALP
LARGSHGDVQEYRLVPTGKGATMEIHLQDGLTALQNPEAFAGFAPDVLLFKNNGLHIELH
FDRNHPVGKAHPAGVKDVVLEAAMTTIVDFEDSIAAVDGEDKAQTYANWLGLLRGDLLAS
FPKGGKTVSRSLSPDRAYTAPDGSPLTLPGRSLLLVRNVGHLMTTNAVLLGSDEVQEGIL
DAMVTGLIALHDLKELGSLRNSRSGSVYIVKPKMHGPEEVAFACDLFDRVEDALGMPRHT
MKIGIMDEERRTSVNLAECIRAAKDRVIFINTGFLDRTGDEIHTSMEAGPMVPKAAMKNA
RWILSYEDWNVDTGLACGFSGKAQIGKGMWAMPDRMKQMVETKQAHPLAGANCAWVPSPT
AATLHAMHYHEVDVFARQAELQRTKRASLNELLTLPLLDHPLSTEEIQRELDNNCQGILG
YVVRWIDQGIGCSKVPDITDVGLMEDRATLRISSQYIANWLHHGLCSLEQVRATLERMAA
VVDRQNQGDPAYRPMAPDFDASIAFEAASDLIFKGREQPSGYTEPILHARRRERKAK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacttatatccctgtcggcggattgaacgtcgcaaagccccttcatgatctgatacgc
gataaagccacgcccggaaccggcgtgacggacacggatttttgggccgcctttgaaaaa
attctgcacgacctgtccccgcgcaaccgcgaactgctggccaagcgccagtatctgcag
gaaaccatcgattcgtggcacaagcggcacaaagacggaccacatgacgccgtcgcctac
gagcagctcctgcgcgagatcggctacatcgtgccggagggcctgcccttctccatcggg
accagcggcgtggacccggaaatatcatccatcgccgggccacaactcgtcgtcccggcc
accaacgcccgctacgccttgaacgcggccaatgcccgctggggcagcctgtacgacgcc
ctgtacggaacggacgtgctctccgaagaaggcggcgcgacacgggagggagcgtacaac
cctgtgcgcgggaccaaggtcatggaattcgcggcccgtttcctggacaaagccctgccc
ctggcccgaggcagccacggtgatgtccaggagtaccggttggtgcccacaggcaaaggc
gccacgatggagattcatttgcaggacggcctgaccgcgctgcaaaacccggaggctttc
gccggattcgcgcccgatgtcctgcttttcaaaaacaacggactgcacatcgaactgcat
ttcgaccgcaatcatcccgtgggcaaggcccatcccgcaggcgtcaaggacgtggtgctg
gaagcggccatgaccactatcgtcgacttcgaggactccatcgccgccgttgacggcgag
gacaaggcccagacgtatgccaactggctgggcctgctgcgcggcgacttgttggcgtcc
tttcccaagggcggcaaaaccgtcagtcgcagcctcagtcccgaccgcgcctacaccgct
cccgacggctcgcccctgaccctgcccggacgcagcctgctgttggtgcgcaacgttggc
catctcatgaccacgaacgcggtcctgctcggctccgacgaagtccaggaaggcatcctt
gacgccatggtcaccggccttatcgccctgcacgacctcaaggagctcggatccctgcgc
aacagccgctccggcagcgtgtatatcgtcaaacccaagatgcatggccccgaagaagtc
gccttcgcctgcgacctgtttgaccgcgtggaagacgcgctgggcatgccccgccacacc
atgaaaatcggaatcatggacgaggagcgcaggacatcggtcaatctggcggaatgcatc
cgcgcggccaaggaccgggtcatcttcatcaacacgggttttctggatcgcaccggcgat
gaaatccacaccagcatggaagccggtcccatggtgcccaaggcggccatgaagaacgcc
cgctggattctgtcctacgaggattggaacgttgacacgggcctggcctgcgggttttcc
ggcaaggcccagatcggcaagggcatgtgggccatgccggaccgtatgaaacagatggtc
gaaaccaagcaggcgcatcccctggccggagccaactgcgcctgggttccgtcccccacg
gccgcgaccctgcacgccatgcactaccatgaagtggatgtctttgcccgtcaggcggaa
ctgcagcgcaccaagagggccagcctgaacgagcttctgaccctgcccctgcttgaccat
cccttgtccacggaggagatccagcgtgaactggacaacaactgccagggcatcctgggc
tacgtggtacgctggatcgaccagggcatcggctgctccaaggtgccggacataaccgac
gtggggctcatggaagaccgcgccaccctgcgcatctccagccaatacatcgccaactgg
ctgcaccatggcctgtgcagcctggaacaggtccgcgccaccctggaacgcatggccgcc
gtggtcgacaggcagaaccaaggcgacccggcctaccgccccatggcccccgacttcgat
gccagcatagcctttgaggccgccagcgacctgatcttcaaaggccgcgagcagccgagc
gggtatacggaacccatcctgcacgccagaagaagggaacgcaaagccaaataa

DBGET integrated database retrieval system